DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD1 and Vars1

DIOPT Version :10

Sequence 1:NP_524326.1 Gene:GstD1 / 41503 FlyBaseID:FBgn0001149 Length:209 Species:Drosophila melanogaster
Sequence 2:NP_035820.3 Gene:Vars1 / 22321 MGIID:90675 Length:1263 Species:Mus musculus


Alignment Length:107 Identity:30/107 - (28%)
Similarity:43/107 - (40%) Gaps:26/107 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 PQVFAKAPA-DPE-AFKKIEAAFEFLNTFLEGQDYAAGDSLTVADIALV-ATVSTFEVAKFEISK 176
            |.:..:.|. ||: |...:..|...|..:|....|.|||:.|:||:|.| |.:..|.......::
Mouse   117 PALGLRGPGQDPQAALGALGKALNPLEDWLRLHTYLAGDAPTLADLAAVTALLLPFRYVLDPSAR 181

  Fly   177 --YANVNRW-------------------YENAKKVT--PGWE 195
              :.||.||                   |..|:.||  ||.|
Mouse   182 RIWGNVTRWFNTCVRQPEFRAVLGEVALYSGARSVTQQPGSE 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD1NP_524326.1 GST_N_Delta_Epsilon 2..75 CDD:239343
GST_C_Delta_Epsilon 89..205 CDD:198287 30/107 (28%)
Vars1NP_035820.3 GST_C_family 92..213 CDD:470672 24/95 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 218..294 3/6 (50%)
PTZ00419 281..1263 CDD:240411
'HIGH' region 343..353
'KMSKS' region 861..865
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.