DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GstD9 and GSTF6

Sequence 1:NP_001287303.1 Gene:GstD9 FlyBaseID:FBgn0038020 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_001184893.1 Gene:GSTF6 AraportID:AT1G02930 Length:208 Species:Arabidopsis thaliana

Alignment Length:214 Identity:49/215 (23%)
Similarity:82/215 (38%) Gaps:47/215 (22%)


  Fly    10 SAPCRSILMTARALGLELNKKQVDLDAGEHLKPEFVKINPQHTIPTLVDDGFAIWESRAILIYLA 74
            |...|.:|:......::.....|:|..|||.|..|:..||...:|...|..|.|:|||||..|:|
plant    12 STATRRVLIALHEKNVDFEFVHVELKDGEHKKEPFILRNPFGKVPAFEDGDFKIFESRAITQYIA 76

  Fly    75 EKYDKDGSLYPKDPQQRAVINQRLFFDLSTLYQSYVYYYYP----QLFEDVKKP----------- 124
            .::...|:......:..|:|...:..:        .:.:.|    .::|.|.||           
plant    77 HEFSDKGNNLLSTGKDMAIIAMGIEIE--------SHEFDPVGSKLVWEQVLKPLYGMTTDKTVV 133

  Fly   125 -ADPDNLKKIDDAFAMFNTLLKGQQYAALNKLTLADFALLATVSTFEISEYDFG--------KYP 180
             .:...|.|:.|   ::...|...:|.|.:..||.|      :.|..:.:|..|        :.|
plant   134 EEEEAKLAKVLD---VYEHRLGESKYLASDHFTLVD------LHTIPVIQYLLGTPTKKLFDERP 189

  Fly   181 EVVRWY------DNAKKVI 193
            .|..|.      .:|:||:
plant   190 HVSAWVADITSRPSAQKVL 208

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GstD9NP_001287303.1 GST_N_Delta_Epsilon 2..75 CDD:239343 23/65 (35%)
GstA 4..187 CDD:223698 46/207 (22%)
GST_C_Delta_Epsilon 89..207 CDD:198287 25/136 (18%)
GSTF6NP_001184893.1 PLN02395 4..208 CDD:166036 49/213 (23%)
GST_N_Phi 4..77 CDD:239351 23/65 (35%)
GST_C_Phi 91..208 CDD:198296 25/134 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2329
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1231780at2759
OrthoInspector 1 1.000 T32125
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
33.060

Return to query results.
Submit another query.