DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD9 and GSTF6

DIOPT Version :10

Sequence 1:NP_650181.1 Gene:GstD9 / 41502 FlyBaseID:FBgn0038020 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_171792.1 Gene:GSTF6 / 839515 AraportID:AT1G02930 Length:208 Species:Arabidopsis thaliana


Alignment Length:112 Identity:21/112 - (18%)
Similarity:42/112 - (37%) Gaps:40/112 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 FQSISGKLKQLKITENLEKSIID-------------------------YLALCQKLPVLVTLRDV 144
            |.|:..:.|:||:..|:.|.::.                         ::||.:|.|.:..:.:.
plant    84 FDSVVQRDKKLKLVLNIRKILVSQPDRMMSLRGLGKYRRDLGLKKRRRFIALLRKYPGVFEIVEE 148

  Fly   145 TEFQI-FAQKSEV------PLRIQ--------YKKRKLKILRISENL 176
            ..:.: |...||.      .:||:        .|.|||.::.|.:.:
plant   149 GAYSLRFKMTSEAERLYLDEMRIRNELEDVLVVKLRKLVMMSIDKRI 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD9NP_650181.1 GstA 1..187 CDD:440390 21/112 (19%)
GSTF6NP_171792.1 GST_N_Phi 4..77 CDD:239351
GST_C_Phi 91..208 CDD:198296 19/105 (18%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.