DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GstD9 and GSTF5

Sequence 1:NP_001287303.1 Gene:GstD9 FlyBaseID:FBgn0038020 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_001322019.1 Gene:GSTF5 AraportID:AT1G02940 Length:281 Species:Arabidopsis thaliana

Alignment Length:216 Identity:58/217 (27%)
Similarity:90/217 (41%) Gaps:23/217 (11%)


  Fly     9 YSAPCRSILMTARALGLELNKKQVDLDAGEHLKPEFVKINPQHTIPTLVDDGFAIWESRAILIYL 73
            ||...|.:|......||..:...|:|.||:..||.|:.|||...:|..:|.|..:.|||||..|:
plant    71 YSTNTRRVLAVLHEKGLSYDPITVNLIAGDQKKPSFLAINPFGQVPVFLDGGLKLTESRAISEYI 135

  Fly    74 AEKYDKDGSLYPKDPQQRAVINQRLF-------FD--LSTL-YQSYVYYYYPQLFEDVKKPADPD 128
            |..:...|:........:.:..||::       ||  .||| ::..:...| .|..|.|...:.:
plant   136 ATVHKSRGTQLLNYKSYKTMGTQRMWMAIESFEFDPLTSTLTWEQSIKPMY-GLKTDYKVVNETE 199

  Fly   129 NLKKIDDAFAMFNTLLKGQQYAALNKLTLADFALLATVSTF--EISEYDFGKYPEVVRWYDNAKK 191
              .|::....::...||...:.|.|..|:||...|..:...  ..::..|...|.|.||.... .
plant   200 --AKLEKVLDIYEERLKNSSFLASNSFTMADLYHLPNIQYLMDTHTKRMFVNRPSVRRWVAEI-T 261

  Fly   192 VIPGWEENWEGCE----YYKK 208
            ..|.|:   ..|:    |:||
plant   262 ARPAWK---RACDVKAWYHKK 279

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GstD9NP_001287303.1 GST_N_Delta_Epsilon 2..75 CDD:239343 26/66 (39%)
GstA 4..187 CDD:223698 52/190 (27%)
GST_C_Delta_Epsilon 89..207 CDD:198287 29/134 (22%)
GSTF5NP_001322019.1 PLN02473 65..268 CDD:166114 54/204 (26%)
GST_N_Phi 65..136 CDD:239351 25/65 (38%)
GST_C_Phi 153..270 CDD:198296 27/124 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2329
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1231780at2759
OrthoInspector 1 1.000 T32125
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
33.060

Return to query results.
Submit another query.