DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GstD9 and GSTF7

Sequence 1:NP_001287303.1 Gene:GstD9 FlyBaseID:FBgn0038020 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_171791.1 Gene:GSTF7 AraportID:AT1G02920 Length:209 Species:Arabidopsis thaliana

Alignment Length:217 Identity:55/218 (25%)
Similarity:82/218 (38%) Gaps:52/218 (24%)


  Fly    10 SAPCRSILMTARALGLELNKKQVDLDAGEHLKPEFVKINPQHTIPTLVDDGFAIWESRAILIYLA 74
            |...|.:|:......|:.....::|..|||.|..|:..||...:|...|..|.::|||||..|:|
plant    12 STATRRVLIALHEKNLDFEFVHIELKDGEHKKEPFIFRNPFGKVPAFEDGDFKLFESRAITQYIA 76

  Fly    75 EKYDKDG----SLYPKDPQQRAV---INQRLFFDLSTLYQSYVYYYYPQLFEDVKKP-------- 124
            ..|...|    ||..||....|:   |....|..:.:          ..::|.|.||        
plant    77 HFYSDKGNQLVSLGSKDIAGIAMGIEIESHEFDPVGS----------KLVWEQVLKPLYGMTTDK 131

  Fly   125 ----ADPDNLKKIDDAFAMFNTLLKGQQYAALNKLTLADFALLATVSTFEISEYDFG-------- 177
                .:...|.|:.|   ::...|...:|.|.:|.||.|      :.|..:.:|..|        
plant   132 TVVEEEEAKLAKVLD---VYEHRLGESKYLASDKFTLVD------LHTIPVIQYLLGTPTKKLFD 187

  Fly   178 KYPEVVRWY------DNAKKVI 193
            :.|.|..|.      .:||||:
plant   188 ERPHVSAWVADITSRPSAKKVL 209

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GstD9NP_001287303.1 GST_N_Delta_Epsilon 2..75 CDD:239343 22/65 (34%)
GstA 4..187 CDD:223698 51/210 (24%)
GST_C_Delta_Epsilon 89..207 CDD:198287 27/135 (20%)
GSTF7NP_171791.1 PLN02395 4..209 CDD:166036 55/216 (25%)
GST_N_Phi 4..77 CDD:239351 22/65 (34%)
GST_C_Phi 95..209 CDD:198296 27/133 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2329
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1231780at2759
OrthoInspector 1 1.000 T32125
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
33.060

Return to query results.
Submit another query.