DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GstD9 and GSTF8

Sequence 1:NP_001287303.1 Gene:GstD9 FlyBaseID:FBgn0038020 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_001323480.1 Gene:GSTF8 AraportID:AT2G47730 Length:263 Species:Arabidopsis thaliana

Alignment Length:195 Identity:54/196 (28%)
Similarity:83/196 (42%) Gaps:20/196 (10%)


  Fly    16 ILMTARALGLELNKKQVDLDAGEHLKPEFVKINPQHTIPTLVDDGFAIWESRAILIYLAEKYDKD 80
            :|.|.....|:.....||:.||.|.:...:.:||...||.|.|....::|||||..||||:|.:.
plant    66 VLATLYEKDLQFELIPVDMRAGAHKQEAHLALNPFGQIPALEDGDLTLFESRAITQYLAEEYSEK 130

  Fly    81 G-SLYPKDPQQ-RAVIN-------QRLFFDLSTLYQSYVYYYYPQLFEDVKKPADPDNLK-KIDD 135
            | .|..:|.:: :|..|       |:...:.|.|....|   :..:|.....||....|: |:..
plant   131 GEKLISQDCKKVKATTNVWLQVEGQQFDPNASKLAFERV---FKGMFGMTTDPAAVQELEGKLQK 192

  Fly   136 AFAMFNTLLKGQQYAALNKLTLADFALLATVSTF--EISEYDFGKYPEVVRWYDNAKKVI--PGW 196
            ...::...|...::.|.:..||||...|..:...  ..|:..|...|:|..|   .||:.  |.|
plant   193 VLDVYEARLAKSEFLAGDSFTLADLHHLPAIHYLLGTDSKVLFDSRPKVSEW---IKKISARPAW 254

  Fly   197  196
            plant   255  254

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GstD9NP_001287303.1 GST_N_Delta_Epsilon 2..75 CDD:239343 22/59 (37%)
GstA 4..187 CDD:223698 50/183 (27%)
GST_C_Delta_Epsilon 89..207 CDD:198287 27/122 (22%)
GSTF8NP_001323480.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2329
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T32125
orthoMCL 1 0.900 OOG5_126942
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
32.950

Return to query results.
Submit another query.