DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GstD9 and Eef1g

Sequence 1:NP_001287303.1 Gene:GstD9 FlyBaseID:FBgn0038020 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_080283.3 Gene:Eef1g MGIID:1914410 Length:437 Species:Mus musculus

Alignment Length:195 Identity:46/196 (23%)
Similarity:83/196 (42%) Gaps:25/196 (13%)


  Fly     8 LYSAP----CRSILMTARALGLELNKKQVDLDAGEHL-------KPEFVKINPQHTIPTLV-DDG 60
            ||:.|    ....|:.|:..|.::..    |.|..|.       .|||::..|...:|... |||
Mouse     6 LYTYPENWRAFKALIAAQYSGAQVRV----LSAPPHFHFGQTNRTPEFLRKFPAGKVPAFEGDDG 66

  Fly    61 FAIWESRAILIYLAEKYDKDGSLYPKDPQQRAVINQRLFFDLSTLYQSYVYYYYPQL-FEDVKKP 124
            |.::||.||..|::.:     .|....|:..|.:.|.:.|..|.:......:.:|.| .....|.
Mouse    67 FCVFESNAIAYYVSNE-----ELRGSTPEAAAQVVQWVSFADSDIVPPASTWVFPTLGIMHHNKQ 126

  Fly   125 ADPDNLKKIDDAFAMFNTLLKGQQYAALNKLTLADFALLATVSTF--EISEYDFGK-YPEVVRWY 186
            |..:..:::.....:.:|.||.:.:....::||||..::.|:...  ::.|..|.: :|...||:
Mouse   127 ATENAKEEVKRILGLLDTHLKTRTFLVGERVTLADITVVCTLLWLYKQVLEPSFRQAFPNTNRWF 191

  Fly   187  186
            Mouse   192  191

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GstD9NP_001287303.1 GST_N_Delta_Epsilon 2..75 CDD:239343 23/79 (29%)
GstA 4..187 CDD:223698 46/196 (23%)
GST_C_Delta_Epsilon 89..207 CDD:198287 21/103 (20%)
Eef1gNP_080283.3 GST_N_EF1Bgamma 4..82 CDD:239342 23/80 (29%)
GstA 5..202 CDD:223698 46/196 (23%)
GST_C_EF1Bgamma_like 91..213 CDD:198290 21/102 (21%)
FinO_conjug_rep <211..>265 CDD:301594
EF1G 275..381 CDD:279041
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.