DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GstD9 and gstt1

Sequence 1:NP_001287303.1 Gene:GstD9 FlyBaseID:FBgn0038020 Length:218 Species:Drosophila melanogaster
Sequence 2:XP_002931957.2 Gene:gstt1 ID: Length:244 Species:Xenopus tropicalis

Alignment Length:203 Identity:59/204 (29%)
Similarity:96/204 (47%) Gaps:30/204 (15%)


  Fly     2 LDFYYMLYSAPCRSILMTARALGLELNKKQVDLDAGEHLKPEFVKINPQHTIPTLVDDGFAIWES 66
            |..|..|.|.||||:.:.|:|..:..|..::.|..||||..||.|::..|.:|.|.|..|.:.||
 Frog     6 LTLYLDLLSQPCRSVYIFAKANRIPFNYCKLQLLKGEHLTQEFGKVSVLHKVPALKDGNFTMAES 70

  Fly    67 RAILIYLAEKYDKDGSLYPKDPQQRAVINQRLFFDLSTL--YQSYVYYYYPQLFEDVKKPADPDN 129
            .|:|:|||.||......||.|.|:||.:::.|.:..:..  :.|.|::         .|...|..
 Frog    71 TAMLLYLARKYKTPNHWYPSDLQKRARVDEYLAWQHTNTRPHGSKVFW---------TKCVSPTI 126

  Fly   130 L------KKIDDAFAMFNT--------LLKGQQYAALNKLTLADFALLATVSTFEISEYD---FG 177
            |      :|::...|.|.|        .|..:.:.|.:::::||  |:|.|...::....   |.
 Frog   127 LGKEVPSEKMNAVMAEFVTTMNNFEEKFLGNKPFIAGDEISVAD--LVAIVEIMQVIASGVNVFE 189

  Fly   178 KYPEVVRW 185
            :.|::..|
 Frog   190 ERPKLGSW 197

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GstD9NP_001287303.1 GST_N_Delta_Epsilon 2..75 CDD:239343 31/73 (42%)
GstA 4..187 CDD:223698 58/202 (29%)
GST_C_Delta_Epsilon 89..207 CDD:198287 23/117 (20%)
gstt1XP_002931957.2 GstA 6..204 CDD:223698 59/204 (29%)
GST_N_Theta 6..81 CDD:239348 32/75 (43%)
GST_C_Theta 94..220 CDD:198292 22/116 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1231780at2759
OrthoFinder 1 1.000 FOG0000104
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.