DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GstD9 and GstD2

Sequence 1:NP_001287303.1 Gene:GstD9 FlyBaseID:FBgn0038020 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_524912.1 Gene:GstD2 FlyBaseID:FBgn0010038 Length:215 Species:Drosophila melanogaster

Alignment Length:209 Identity:129/210 (61%)
Similarity:162/210 (77%) Gaps:2/210 (1%)


  Fly     2 LDFYYMLYSAPCRSILMTARALGLELNKKQVDLDAGEHLKPEFVKINPQHTIPTLVDDGFAIWES 66
            :|||||.....||:::|.|:|||||||||.::...||.|||||||:|||||||||||:||:||||
  Fly     1 MDFYYMPGGGGCRTVIMVAKALGLELNKKLLNTMEGEQLKPEFVKLNPQHTIPTLVDNGFSIWES 65

  Fly    67 RAILIYLAEKYDKDGSLYPKDPQQRAVINQRLFFDLSTLYQSYVYYYYPQLFEDVKKPADPDNLK 131
            |||.:||.|||.||..|.|.||::||||||||:||:.|||:|:..|||| ||. ..||...::||
  Fly    66 RAIAVYLVEKYGKDDYLLPNDPKKRAVINQRLYFDMGTLYESFAKYYYP-LFR-TGKPGSDEDLK 128

  Fly   132 KIDDAFAMFNTLLKGQQYAALNKLTLADFALLATVSTFEISEYDFGKYPEVVRWYDNAKKVIPGW 196
            :|:.||...:|.|:||:|.|.::||:||.|:|:||||||:||:||.||..|.|||||||||.|||
  Fly   129 RIETAFGFLDTFLEGQEYVAGDQLTVADIAILSTVSTFEVSEFDFSKYSNVSRWYDNAKKVTPGW 193

  Fly   197 EENWEGCEYYKKLY 210
            :|||||....|.|:
  Fly   194 DENWEGLMAMKALF 207

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GstD9NP_001287303.1 GST_N_Delta_Epsilon 2..75 CDD:239343 49/73 (67%)
GstA 4..187 CDD:223698 112/183 (61%)
GST_C_Delta_Epsilon 89..207 CDD:198287 69/118 (58%)
GstD2NP_524912.1 GST_N_Delta_Epsilon 1..74 CDD:239343 49/73 (67%)
GST_C_Delta_Epsilon 88..204 CDD:198287 69/118 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131161023
eggNOG 1 0.900 E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2329
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1231780at2759
OrthoFinder 1 1.000 FOG0000104
orthoMCL 1 0.900 OOG5_126942
Panther 1 1.100 P PTHR43969
RoundUp 00.000 Not matched by this tool.
76.890

Return to query results.
Submit another query.