DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GstD9 and GstD1

Sequence 1:NP_001287303.1 Gene:GstD9 FlyBaseID:FBgn0038020 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_001034042.1 Gene:GstD1 FlyBaseID:FBgn0001149 Length:209 Species:Drosophila melanogaster

Alignment Length:210 Identity:138/211 (65%)
Similarity:172/211 (82%) Gaps:2/211 (1%)


  Fly     1 MLDFYYMLYSAPCRSILMTARALGLELNKKQVDLDAGEHLKPEFVKINPQHTIPTLVDDGFAIWE 65
            |:||||:..|:||||::|||:|:|:|||||.::|.|||||||||:|||||||||||||:|||:||
  Fly     1 MVDFYYLPGSSPCRSVIMTAKAVGVELNKKLLNLQAGEHLKPEFLKINPQHTIPTLVDNGFALWE 65

  Fly    66 SRAILIYLAEKYDKDGSLYPKDPQQRAVINQRLFFDLSTLYQSYVYYYYPQLFEDVKKPADPDNL 130
            ||||.:||.|||.|..|||||.|::||||||||:||:.|||||:..|||||:|  .|.||||:..
  Fly    66 SRAIQVYLVEKYGKTDSLYPKCPKKRAVINQRLYFDMGTLYQSFANYYYPQVF--AKAPADPEAF 128

  Fly   131 KKIDDAFAMFNTLLKGQQYAALNKLTLADFALLATVSTFEISEYDFGKYPEVVRWYDNAKKVIPG 195
            |||:.||...||.|:||.|||.:.||:||.||:|||||||:::::..||..|.|||:|||||.||
  Fly   129 KKIEAAFEFLNTFLEGQDYAAGDSLTVADIALVATVSTFEVAKFEISKYANVNRWYENAKKVTPG 193

  Fly   196 WEENWEGCEYYKKLY 210
            |||||.||..:||.:
  Fly   194 WEENWAGCLEFKKYF 208

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GstD9NP_001287303.1 GST_N_Delta_Epsilon 2..75 CDD:239343 53/73 (73%)
GstA 4..187 CDD:223698 120/183 (66%)
GST_C_Delta_Epsilon 89..207 CDD:198287 72/118 (61%)
GstD1NP_001034042.1 GST_N_Delta_Epsilon 2..75 CDD:239343 53/73 (73%)
GstA 4..185 CDD:223698 120/183 (66%)
GST_C_Delta_Epsilon 89..205 CDD:198287 72/118 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131160670
eggNOG 1 0.900 E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2329
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1231780at2759
OrthoFinder 1 1.000 FOG0000104
orthoMCL 1 0.900 OOG5_126942
Panther 1 1.100 P PTHR43969
RoundUp 00.000 Not matched by this tool.
76.890

Return to query results.
Submit another query.