DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GstD9 and eef1e1

Sequence 1:NP_001287303.1 Gene:GstD9 FlyBaseID:FBgn0038020 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_001107137.1 Gene:eef1e1 XenbaseID:XB-GENE-493638 Length:174 Species:Xenopus tropicalis

Alignment Length:164 Identity:35/165 (21%)
Similarity:69/165 (42%) Gaps:29/165 (18%)


  Fly    53 IPTL-VDDGFAIWESRAILIYLAEKYDKDGSLYPKDPQQRAVINQRLFFDLSTLYQSYVYYYYPQ 116
            ||.| .:.|.::.....|..:|.::..|: .|.....:::|::.|.|.:.:|       |.....
 Frog    30 IPVLQTNKGPSLVGLSTIASHLVKEAKKE-ELLGSTAEEKAIVQQWLEYRIS-------YIDRAS 86

  Fly   117 LFEDVKKPADPDNLKKIDDAFAMFNTLLKGQQYAALNKLTLAD----FALLATVSTFEISEYDFG 177
            ..||::        ..::|    .|..||.:.:.|.|.:||||    :.|...::...:.|.:  
 Frog    87 SKEDIR--------NVLND----LNHYLKDKVFVAGNTVTLADILIYYGLHPVITGLSVQEKE-- 137

  Fly   178 KYPEVVRWYDNAKKVIPGWEENWEGCEYYK-KLY 210
            .|..|.||:.:.:. .||..::.....:.| ::|
 Frog   138 TYINVSRWFSHIQN-YPGIRQHLPSLVFIKNRIY 170

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GstD9NP_001287303.1 GST_N_Delta_Epsilon 2..75 CDD:239343 6/23 (26%)
GstA 4..187 CDD:223698 31/139 (22%)
GST_C_Delta_Epsilon 89..207 CDD:198287 25/122 (20%)
eef1e1NP_001107137.1 GST_C_AIMP3 65..165 CDD:198338 25/122 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.