DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3942 and gdpd5b

DIOPT Version :8

Sequence 1:NP_650171.2 Gene:CG3942 / 41489 FlyBaseID:FBgn0038008 Length:739 Species:Drosophila melanogaster
Sequence 2:XP_005157799.1 Gene:gdpd5b / 560645 ZFINID:ZDB-GENE-030131-6028 Length:584 Species:Danio rerio

Alignment Length:86 Identity:23/87 (26%)
Similarity:39/87 (45%) Gaps:8/87 (9%)


  Fly   370 IGHKGSGNTYRLGSDVVRENTLYGFKQAVLANADMVEMDVQLTQDAQVVVYHDFVLRFMLQRMPS 434
            |||:|:       ..:..||||..|.:|:..|...:|.||.::.|....:..|..||........
Zfish   231 IGHQGA-------PMLAPENTLLSFNRALQRNVSGLETDVTISLDGVPFLMRDRTLRRTTNVRRV 288

  Fly   435 FEDLLENQDLLIFAYENLNKL 455
            |.: .:.:|..:|.:.:|:.|
Zfish   289 FPE-RQYEDASLFNWTDLSTL 308

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3942NP_650171.2 CBM20_Prei4 44..164 CDD:99888
GDPD_GDE5 368..684 CDD:176549 23/87 (26%)
GDPD 372..685 CDD:281062 21/85 (25%)
gdpd5bXP_005157799.1 ESSS <23..74 CDD:301731
GDPD_GDE2 227..582 CDD:176550 23/87 (26%)
GDPD 233..460 CDD:281062 21/85 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0584
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.