DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3942 and T12B3.3

DIOPT Version :8

Sequence 1:NP_650171.2 Gene:CG3942 / 41489 FlyBaseID:FBgn0038008 Length:739 Species:Drosophila melanogaster
Sequence 2:NP_501176.1 Gene:T12B3.3 / 177509 WormBaseID:WBGene00020446 Length:356 Species:Caenorhabditis elegans

Alignment Length:290 Identity:62/291 (21%)
Similarity:100/291 (34%) Gaps:119/291 (41%)


  Fly   340 YLIIRP----LPNFRCDLSHSYERYWRKNRLC--MNI----------GHKGSGNTYRLGSDVVRE 388
            |||..|    :|     ||.....|..||..|  .|:          ||:|:..::       .|
 Worm    25 YLIYPPGLLLIP-----LSLFIFSYTTKNEKCSSKNVDTFFSGFKIGGHRGAPKSF-------PE 77

  Fly   389 NTLYGFKQAVLANADMVEMDVQLTQDAQVVVYHDFVL--------------RFML---------- 429
            |::.||.||....||::|.||.||:|.:.|:.||..|              |..|          
 Worm    78 NSMAGFAQAKADGADLIEFDVALTKDGKAVLMHDDDLDRTTDMKGPIRDKTRAELDRCDISATFK 142

  Fly   430 ---------------QRMPSFEDL----LENQDLLIF------------------AYENLNKLML 457
                           :|:|..||:    :||...::|                  .|...:|.::
 Worm   143 RTAPGDHCRLATVSRERVPDMEDVVKWAVENNTRMLFDVKDSDNELVDQIANLFQKYNLYDKAIV 207

  Fly   458 ----------LAMGGSKRKDLIAVPLEAFSYDQLKEVKVLRFAGSKGCDKSCDRMLLEQ------ 506
                      :..|..|....:...|:.:||..::.::. |::|.|       :||.|.      
 Worm   208 CSFFPWVVYRIKKGDQKILTGLTWRLKFWSYHDIENIRP-RYSGPK-------QMLFEMIDVAHV 264

  Fly   507 ------RPFPLLLDLLDEENLPVDMGFLIE 530
                  .|:.|..|||...||.:....:::
 Worm   265 WLLKKVTPWYLGADLLLTNNLDISQALIMD 294

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3942NP_650171.2 CBM20_Prei4 44..164 CDD:99888
GDPD_GDE5 368..684 CDD:176549 51/257 (20%)
GDPD 372..685 CDD:281062 49/243 (20%)
T12B3.3NP_501176.1 GDPD_GDE1 65..329 CDD:176515 50/246 (20%)
GDPD 68..331 CDD:281062 49/243 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0584
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.