DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cog1 and Cog1

Sequence 1:NP_001262497.1 Gene:Cog1 FlyBaseID:FBgn0037998 Length:886 Species:Drosophila melanogaster
Sequence 2:NP_001100532.2 Gene:Cog1 RGDID:1304594 Length:980 Species:Rattus norvegicus

Alignment Length:1015 Identity:255/1016 (25%)
Similarity:431/1016 (42%) Gaps:200/1016 (20%)


  Fly    11 DTLFEQHSVSEIDEVHKKIQSVVENKREELRTHVGERYRDLLQAADTIAAMQTSAGTLMEQVRHV 75
            :.|||.|...||..:.:::::.:|:|:||||..||||||||::|||||..|:..|..|::.|:..
  Rat    19 NALFETHGAEEIRGLERQVRAEIEHKKEELRQMVGERYRDLIEAADTIGQMRRCAEGLVDAVQAT 83

  Fly    76 QANCRSLNEQQLLGFQSTANASAKDAALKERNAGKKLQTYYGTMAQIKLLTALPELIWTHLDNDR 140
            ...|..|.       |:.:.||....|.:.....:|   :|...||||||..:||.||:.::..:
  Rat    84 DQYCARLR-------QAGSAASRVPRAPQPHPPSEK---FYSMAAQIKLLLEIPEKIWSCMEASQ 138

  Fly   141 FYAATELFIFSRHISTGLQLDGQSA----LMQKLPVARKQWEILRPFHVTIKQAILTALEREELL 201
            ...||:|::...|:.:.||||..|:    ::.:.|:..:|......|..||.......|:.:.:.
  Rat   139 HLQATQLYLLCCHLHSLLQLDSSSSRYSPILSRFPILVRQVAAASHFRSTILHESKMLLKCQAVS 203

  Fly   202 QEMTVDCLQSLLLLDKSDLSTVLKSFLNLRSSAFLNCLQSGPSEPRRVKDRILASLNVLNSTVE- 265
            .:...:.|.|::||::|.....|..|| |...|.:..|.:.|.....:|.:|.:.:.:|.:|:. 
  Rat   204 DQAVAEALCSIMLLEESSPRQALTDFL-LARKATIQTLLNQPHHGAGIKAQICSLVELLATTLNQ 267

  Fly   266 -----------LLDKCLLGYSLLFSRLEECASSTCPPSINRMESSERQLVHL------------L 307
                       :|....|...||||.||         ::.|...:.:.:..|            |
  Rat   268 AHALFYTLPEGVLPDPSLPCGLLFSTLE---------TVTRQHPTGKGISALQGEMKLCSWFRHL 323

  Fly   308 PEIIAGFKPQFD--VPQLTPEQLGSSLQQWLDKMNALAAAHLQQVFALVTNMQTIQDIKSA---- 366
            |..:..|:|...  ...::.|.|..:|::|:|..:......:..:...|.:|:.:..|:.|    
  Rat   324 PASVTEFQPALRTLAHPISQEYLKGTLRKWIDMCSEDIKNGIGNLLMYVKSMKGLAGIRDAIWDL 388

  Fly   367 --------------ARTNGRP--DFVRLEQQLHLKRSQ------LDFYARKYVPLINARVREIIR 409
                          .|...:|  .:..|.|||.|.|.|      .|..:.....|:.:.::|:..
  Rat   389 LTNESASHSWEVVCQRLLEKPLLFWEDLMQQLFLDRLQTLTREGFDSISSSSKELLVSALQELEA 453

  Fly   410 SSWASAMKLTYEQVLLLIEAGQSQPPLQIWREQSDDLPLSLAAALSDQPKRLANRTK-GYDGATI 473
            ::..|...:.:||.:          .|.:|.|..:||| |.||.:|     :|||.: ...|.::
  Rat   454 NNSTSNKHVHFEQNM----------SLYLWSESPNDLP-SDAAWVS-----VANRAQFANSGLSM 502

  Fly   474 E----------LCKRFDSHLADIVQEL--------NVMLQEQTTRAEDKVSLIEFLRE--TAEEQ 518
            :          .|...||.|...:.:|        ..:|::.|...:.|.|..:...:  |.::.
  Rat   503 KAQAISPCVQNFCSALDSKLKVKLDDLLAYLPSSDTPLLKDTTHTHQAKTSAFDRYADAGTVQDM 567

  Fly   519 L-TEYLSNLKGL------ELR----------------ERPALLLALRNSLALVELCPNLKLCF-- 558
            | |:.::.:|.:      |||                :..|:|...|...:|.||||:||.|.  
  Rat   568 LRTQSVACIKSVVGCIQAELRVIEEVTQDQKDVLHSTKLHAVLFMARLCQSLGELCPHLKQCIVG 632

  Fly   559 -CQPS-----SWRQWTDNSAG-----LGIE-HWQRICGLIEKEMLSFWLVIVDDVLAGHNCEEKL 611
             |..|     ..|.......|     |.:: .||.:     ||:|     :...|:|.......|
  Rat   633 KCGGSEKPAREVRALKKQGKGKAQDVLPVQAQWQEV-----KEVL-----LQQSVMAYRVWSAAL 687

  Fly   612 PKVI----NHEVVLSD-------FALWQTLTLEQRDEDQEQSVQSTIRIPSQPRLSLQTYLHQLI 665
            .||:    ...::|||       ...|..|.: |.:.:...||.|.||:|:||...:|::|..|.
  Rat   688 VKVLICGFTQSLLLSDAGSVLATATSWDELEI-QEETESGSSVTSKIRLPTQPSWYVQSFLFSLC 751

  Fly   666 QALNSVVPQTLPPKVLQAFIQRLIGKLLCHYEGLAHAECTK------ASQNIALQLYFDLKFLER 724
            |.:|.|....||...||..::..:.:::..||.|......|      .:||.||||.:||::|..
  Rat   752 QEVNRVGGHALPKITLQEMLKTCMAQVIAAYEQLTEENQIKKEGTFPMTQNRALQLLYDLRYLNI 816

  Fly   725 VFAISREE----RTLYD-QIHAQQNQLRDYIDPFDFELFAEHITAHVSRAASRLQGELGVLTPSA 784
            |.....||    |:..| :|....::|...|||||.::|..|:.::::|...|.....|::|   
  Rat   817 VLTSKGEEVKSSRSKSDSRIEKMADRLEALIDPFDLDVFTPHLNSNLNRLVQRTSVLFGLVT--- 878

  Fly   785 AAPSQGAAAASSLAHEADPNVLCLSSSGSTSLWFPLLPIVM-----PQAAGRVTSAERKSPIQEP 844
            ...:|.|:.:|:...:...|:|.|:||   .:.|.|||:.|     .:|.||  ..|.::.:..|
  Rat   879 GTENQFASRSSTFNSQEPHNILPLASS---QIRFGLLPLSMTSTRKARATGR--GIESQTQVGPP 938

  Fly   845 VEKTATTTPTRKSGGNGARKGDSSKSKSSAASFFGMSQEW 884
            . .:....||... |:..|:..|.:..|.|.|.|.::  |
  Rat   939 A-LSRVGDPTAHP-GSLFRQLASEEDGSPAPSLFKLA--W 974

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cog1NP_001262497.1 Vps51 4..84 CDD:285862 31/73 (42%)
Cog1NP_001100532.2 Vps51 17..91 CDD:285862 31/72 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C342042453
eggNOG 1 0.900 E1_KOG2033
Hieranoid 1 1.000
Homologene 1 1.000 H8411
Inparanoid 1 1.050 195 1.000 Inparanoid score I3689
OMA 1 1.010
OrthoDB 1 1.010 D221637at2759
OrthoFinder 1 1.000 FOG0005778
OrthoInspector 1 1.000 T1087707
orthoMCL 1 0.900 OOG5_131971
Panther 1 1.100 LDO PTHR31658
Phylome 00.000 Not matched by this tool.
TreeFam 1 0.960
1211.860

Return to query results.
Submit another query.