DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14736 and CG33253

DIOPT Version :8

Sequence 1:NP_001287293.1 Gene:CG14736 / 41466 FlyBaseID:FBgn0037986 Length:473 Species:Drosophila melanogaster
Sequence 2:NP_001259699.1 Gene:CG33253 / 2768889 FlyBaseID:FBgn0030992 Length:414 Species:Drosophila melanogaster

Alignment Length:295 Identity:134/296 (45%)
Similarity:209/296 (71%) Gaps:16/296 (5%)


  Fly    15 EMSKHDQKIPPKEFKRPSADGGPRPP--PSRYIQTSEDNKDSTFEKVAIGICWFLVIITFPFSMC 77
            :.|:|...|||             ||  |.:.::|||::.....|.:|..:...::::|||.|:.
  Fly    39 QSSQHAVHIPP-------------PPSLPYQGLKTSENDDMGCVEILATVVSVLIMVLTFPISVF 90

  Fly    78 CCLTIVPEYSRMIILRLGRLRK-GLRGPGLVFILPCIDETHRVDMRTDVTNVRPQDVLTKDSVTI 141
            .|..:|.||.|.:|.|:||||. |.||||:.|:|||:|:.:.||:||...:|.||:||:|||||:
  Fly    91 ICFKVVSEYERAVIFRMGRLRSGGARGPGVFFVLPCVDDYYPVDLRTVSFDVPPQEVLSKDSVTV 155

  Fly   142 TVNAVVYYCIYSPIDSIIQVDDAKQATQLISQVTLRNIVGSKTLNVLLTSRQQLSREIQQAVAGI 206
            ||:|||||.|..|:.::|||.:...:|.|::..||||::|::.|:.|||.|:.:|..:|.::...
  Fly   156 TVDAVVYYRISDPLKAVIQVYNYSHSTSLLAATTLRNVLGTRNLSELLTERETISHTMQMSLDEA 220

  Fly   207 TYRWGVRVERVDVMDITLPTSLERSLASEAEAVREARAKIILAEGELKASKALKEASDVMSENKI 271
            |..|||:||||::.|::|||:|:|::|:||||.||||||:|.||||:|:|:||:|||:::|.:..
  Fly   221 TDPWGVKVERVEIKDVSLPTALQRAMAAEAEAAREARAKVIAAEGEMKSSRALREASEIISASPS 285

  Fly   272 TLQLRHLQILSSIASERRVRIIYPIPLEIMEPFMS 306
            .||||:||.||||::|:...||:|:|:|::.||::
  Fly   286 ALQLRYLQTLSSISTEKNSTIIFPLPMELLTPFLN 320

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14736NP_001287293.1 PHB 78..225 CDD:214581 71/148 (48%)
SPFH_like 100..305 CDD:302763 106/205 (52%)
CG33253NP_001259699.1 PHB 92..239 CDD:214581 71/147 (48%)
SPFH_SLP-4 112..319 CDD:259813 106/207 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C45249840
eggNOG 1 0.900 E1_COG0330
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1062075at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10264
RoundUp 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.