DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14736 and sto-1

DIOPT Version :8

Sequence 1:NP_001287293.1 Gene:CG14736 / 41466 FlyBaseID:FBgn0037986 Length:473 Species:Drosophila melanogaster
Sequence 2:NP_509281.1 Gene:sto-1 / 181017 WormBaseID:WBGene00006063 Length:330 Species:Caenorhabditis elegans

Alignment Length:301 Identity:121/302 (40%)
Similarity:201/302 (67%) Gaps:13/302 (4%)


  Fly    21 QKIPPKEFKRPSADGGPRPPPSRYIQTSEDNKD---STFEKVAIGICWFLVIITFPFSMCCCLTI 82
            :.:..:|..:||  |..|...:| :|::..|..   ...|...|.:.:.|:.:|||.|:..|:.|
 Worm     5 ETVEMQEMAQPS--GQQRDVEAR-VQSAPANHSHDAGCTEMFCIAMSYVLIFLTFPVSVFMCIKI 66

  Fly    83 VPEYSRMIILRLGRLRKGLRGPGLVFILPCIDETHRVDMRTDVTNVRPQDVLTKDSVTITVNAVV 147
            |.||.|.::.|||||...::|||:.||:||||....:|:|....||..|::|::||||::|:|||
 Worm    67 VQEYQRAVVFRLGRLVPDVKGPGIFFIIPCIDTFLNIDLRVASYNVPSQEILSRDSVTVSVDAVV 131

  Fly   148 YYCIYSPIDSIIQVDDAKQATQLISQVTLRNIVGSKTLNVLLTSRQQLSREIQQAVAGITYRWGV 212
            |:.::.||.|::.|.:|..:|:|::|.|||.|:|:.||:.:|:.|:::|.:::.::...|..||:
 Worm   132 YFKVFDPITSVVGVGNATDSTKLLAQTTLRTILGTHTLSEILSDREKISADMKISLDEATEPWGI 196

  Fly   213 RVERVDVMDITLPTSLERSLASEAEAVREARAKIILAEGELKASKALKEASDVMSENKITLQLRH 277
            :||||::.|:.||:.::|::|:||||.|:|.||||.|||||:||.||.||:.::|:::..:|||:
 Worm   197 KVERVELRDVRLPSQMQRAMAAEAEATRDAGAKIIAAEGELRASAALAEAATIISKSEGAMQLRY 261

  Fly   278 LQILSSIASERRVRIIYPIPLEIMEPFMSGKEGQKKDGGGG 318
            |..|::|:||:...||:|.|:||:       .|..|.|.||
 Worm   262 LHTLNAISSEKTSTIIFPFPMEIL-------GGISKVGSGG 295

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14736NP_001287293.1 PHB 78..225 CDD:214581 62/147 (42%)
SPFH_like 100..305 CDD:302763 90/205 (44%)
sto-1NP_509281.1 PHB 62..220 CDD:214581 66/158 (42%)
SPFH_like 86..283 CDD:302763 88/197 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1062075at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10264
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.