DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14736 and Phb2

DIOPT Version :9

Sequence 1:NP_001287293.1 Gene:CG14736 / 41466 FlyBaseID:FBgn0037986 Length:473 Species:Drosophila melanogaster
Sequence 2:NP_031557.2 Gene:Phb2 / 12034 MGIID:102520 Length:299 Species:Mus musculus


Alignment Length:231 Identity:53/231 - (22%)
Similarity:105/231 - (45%) Gaps:46/231 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 RLGRLRKG-LRGPGLVFILPCIDETHRVDMRTDVTNVRPQDVL----TKDSVTITVNAVVYYCIY 152
            |:|.:::. :...||.|.:|........|:|     .||:.:.    :||...:.::..|   :.
Mouse    54 RIGGVQQDTILAEGLHFRIPWFQYPIIYDIR-----ARPRKISSPTGSKDLQMVNISLRV---LS 110

  Fly   153 SP----IDSIIQ---VDDAKQATQLISQVTLRNIVGSKTLNVLLTSRQQLSREIQQAVAGITYRW 210
            .|    :.|:.|   :|..::....|....|:::|.....:.|:|.|.|:|..|::.:......:
Mouse   111 RPNAQELPSMYQRLGLDYEERVLPSIVNEVLKSVVAKFNASQLITQRAQVSLLIRRELTERAKDF 175

  Fly   211 GVRVERVDVMDITLPTSLERSLASEAEAV----------------REARAKIILAEGELKASKAL 259
            .:.::.|.:.:::.  |.|.:.|.||:.|                :|.|.||:.||||.:|:|.|
Mouse   176 SLILDDVAITELSF--SREYTAAVEAKQVAQQEAQRAQFLVEKAKQEQRQKIVQAEGEAEAAKML 238

  Fly   260 KEASDVMSENKITLQLRHLQILSSIA-----SERRV 290
            .||   :|:|...::||.::...:|:     |:.|:
Mouse   239 GEA---LSKNPGYIKLRKIRAAQNISKTIATSQNRI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14736NP_001287293.1 PHB 78..225 CDD:214581 27/143 (19%)
SPFH_like 100..305 CDD:302763 51/224 (23%)
Phb2NP_031557.2 Necessary for transcriptional repression. /evidence=ECO:0000250|UniProtKB:Q99623 19..49
SPFH_prohibitin 40..235 CDD:259799 41/190 (22%)
Necessary for transcriptional repression. /evidence=ECO:0000250|UniProtKB:Q99623 150..174 6/23 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.