DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14736 and stom

DIOPT Version :8

Sequence 1:NP_001287293.1 Gene:CG14736 / 41466 FlyBaseID:FBgn0037986 Length:473 Species:Drosophila melanogaster
Sequence 2:XP_004916682.1 Gene:stom / 100379777 XenbaseID:XB-GENE-995463 Length:303 Species:Xenopus tropicalis

Alignment Length:317 Identity:135/318 (42%)
Similarity:202/318 (64%) Gaps:28/318 (9%)


  Fly     1 MNDQNERKDAATNS---EMSKHDQKIPPKEFKRPSADGGPRPPPSRYIQTSEDNKDSTFEKVAIG 62
            ||...:...|....   :.|..|...|..:.:|.:.:       .|.|:.|:.         .:|
 Frog     1 MNRVGDSNSAGAQGFLVDPSDRDMADPELKSRRANQE-------DRNIEESDG---------GLG 49

  Fly    63 IC-WFLVI-------ITFPFSMCCCLTIVPEYSRMIILRLGR-LRKGLRGPGLVFILPCIDETHR 118
            .| |||||       :|||.|:..|:.||.||.|.||.|||| ||.|.:||||.|:|||.|....
 Frog    50 CCGWFLVILSFFFTLLTFPISVWMCIKIVKEYERAIIFRLGRILRGGAKGPGLFFVLPCTDSFIN 114

  Fly   119 VDMRTDVTNVRPQDVLTKDSVTITVNAVVYYCIYSPIDSIIQVDDAKQATQLISQVTLRNIVGSK 183
            |||||...::.||::|||||||::|:.||||.:.:...::..:.:|..||:|::|.||||::|:|
 Frog   115 VDMRTISFDIPPQEILTKDSVTVSVDGVVYYRVNNATLAVANITNADSATRLLAQTTLRNVLGTK 179

  Fly   184 TLNVLLTSRQQLSREIQQAVAGITYRWGVRVERVDVMDITLPTSLERSLASEAEAVREARAKIIL 248
            .|:.:|:.|::::..:|..:...|..||::||||::.|:.||..|:|::|:||||.||||||:|.
 Frog   180 NLSQILSDREEIAHNMQSTLDVATDDWGIKVERVEIKDVKLPVQLQRAMAAEAEAAREARAKVIA 244

  Fly   249 AEGELKASKALKEASDVMSENKITLQLRHLQILSSIASERRVRIIYPIPLEIMEPFM 305
            ||||:.||:||||||.|:||:...||||:||.|::||||:...|::|:||::::.||
 Frog   245 AEGEMNASRALKEASIVISESPAALQLRYLQTLTTIASEKNSTIVFPLPLDLLKGFM 301

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14736NP_001287293.1 PHB 78..225 CDD:214581 67/148 (45%)
SPFH_like 100..305 CDD:302763 99/205 (48%)
stomXP_004916682.1 PHB 73..225 CDD:214581 69/152 (45%)
SPFH_stomatin 94..295 CDD:259801 99/201 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1062075at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.