DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ssp5 and CG13127

Sequence 1:NP_650149.1 Gene:ssp5 FlyBaseID:FBgn0037985 Length:711 Species:Drosophila melanogaster
Sequence 2:NP_609338.1 Gene:CG13127 FlyBaseID:FBgn0032176 Length:734 Species:Drosophila melanogaster

Alignment Length:770 Identity:195/771 (25%)
Similarity:331/771 (43%) Gaps:150/771 (19%)


  Fly    12 WYTNLSDFQVQAVEALAFSIRDDNAEGTVYRTQFCLSRLGVTPMVKTRMLRKLIGICRGSDLAFL 76
            ||..:|..|::|.:.|..::|||..:|:.||.:.|:::||:.|.|....::.:|.:.:|||||||
  Fly    17 WYRGMSVVQMKACDELLHALRDDMEQGSTYRVRHCITQLGIYPPVGAAQIKDIIAMSQGSDLAFL 81

  Fly    77 YFLMEACYK-----GTGSAYS--------ERILMSAITFLDLEMTMRELDKILPPGVERLNKKES 128
            :||.|..||     |..:..|        |::|:|.|..||:..|:|.||.:|||..:       
  Fly    82 WFLWEFAYKSPPKCGKDNCNSDSEHFTVNEQLLLSGIAHLDMPSTLRALDALLPPATQ------- 139

  Fly   129 IAPPVDYRSMSLPTPLPTKRESDLRKVRS------PYFTPLPKPK--LPKGGEKFTAKRPCLVVS 185
                    |..|.:.:.|:::|.:.:.|.      |||.||.:|:  :||.  ||  :.|...:.
  Fly   140 --------SKKLNSQIKTEQKSSIPRRRKPKNYDLPYFAPLVRPREYIPKC--KF--RPPETKLL 192

  Fly   186 FPFWPAG-ERPNYKVNEENRWFAAYRFQPVKRMLFKMVGDIMTDYWTKIDGTQPAENEAMPMCEF 249
            ||.:... :|.....||.:||||.|:..|.||::.|::.|.:.....|.|..  .|:.| |:||.
  Fly   193 FPEYSHYIDRMKQIPNEGSRWFAQYKLCPAKRVVNKLLRDQLNGISLKWDDN--LEDNA-PVCET 254

  Fly   250 HKEALRQEQLVKDAAVVKAHKQCLALVDITSRQDALLKKRIVAQLERDIEEVTLRWKRLRERHHT 314
            |:...:.|.|.|...::|  :.|:.::|:...:....:|.|:..:|.::     :|...|.....
  Fly   255 HRFLKKVENLQKQEKILK--QPCVTMLDVVGDELKARRKHILNDIENNV-----KWASKRMNRQL 312

  Fly   315 DVMLLEDHDQMCSVGKVPTAVQDIRIKY-------LSQEADIGRLSAKPTL--GIHVITGRGNVS 370
            .:        ....||:|......|.|.       |..|.::...|...:|  .|.|:..:||.|
  Fly   313 GI--------TSGPGKLPKGSCTARKKKEPTILIGLGNEENLRLHSYAHSLNNSIRVMLMKGNES 369

  Fly   371 RLSKVRVSDPDD---DIPCPTVPVEQK----LAKCPPPILGHI-KRPRKVSITKSKFGD------ 421
            .    |....|.   |:.|     |.|    :...|..:...| ::||..:.:..|..|      
  Fly   370 H----RCGAGDCKILDVDC-----EMKGSAEITMKPQNVKSFIEEKPRLPTSSFKKLADLIPVCS 425

  Fly   422 -----DKQSSCKKPSKPG--------------RFFEAPHQH-SPFVFKYHAVAPQDQNPDTKDVI 466
                 .|:||.|.|::..              :.|:.|... .|..::...:..:|:.|    ||
  Fly   426 RTLRSLKRSSPKAPAEESFTNRSIGGFQLDYHKIFDVPSPPVEPLPWEEEVLDLEDKQP----VI 486

  Fly   467 RAQAIRTLKEQSCPSSEDNYNGRINPRDQVVAAIVECAQNMWFGSLEAHQRRLSSGQSERPTTIE 531
            ....|..|......|.::....:.||  .|..:..:||.||:...|..:                
  Fly   487 ERLCIDALGNDDNKSKKELLRNKSNP--VVSRSAAKCAVNMFRSKLAEN---------------- 533

  Fly   532 VPAKNEPEEICKTN-DALDWTKTIKKFDPNNQHLMERLLRDGFSVLRQDPRCVFAAFPDSHKSFV 595
              |:|:.::..|.| |.|        .||::...:|.||::...|||.:.:.|.|...::||..|
  Fly   534 --AENQDDKHIKQNGDIL--------IDPDDDEQIESLLKEALRVLRGNRQYVLATLSNAHKMPV 588

  Fly   596 MVEWIKRRYGKTYCHEEIVDTIEKGLATF--VHVENQLNEAP--SAKRE--GFSAKDTFDDFKRL 654
            :::|:..||||:||...:...::.....:  |:.:.:.|:..  ..||.  |..:..::...|:.
  Fly   589 LLDWVADRYGKSYCRAGMKSIVKTSFRIYEKVYEKERRNKRNMLELKRSVTGLGSSISYASHKKF 653

  Fly   655 EALCKKLKTEYRMPLNDKILTLTRICWSALSPHLARSSSMLKTFFAYLPVRYADM 709
            .:...:.|.||...||:..|..:|:.|.||..:.....|:..|||||:|.|..|:
  Fly   654 MSQVVQRKAEYNNKLNELALEQSRLTWLALRGYSHLGGSIKDTFFAYMPARPQDI 708

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ssp5NP_650149.1 DUF4770 47..218 CDD:292613 61/193 (32%)
DUF4771 555..709 CDD:292614 45/160 (28%)
CG13127NP_609338.1 DUF4770 52..226 CDD:292613 61/193 (32%)
DUF4771 550..708 CDD:292614 45/158 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2C9W7
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR41967
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.