| Sequence 1: | NP_650149.1 | Gene: | ssp5 / 41465 | FlyBaseID: | FBgn0037985 | Length: | 711 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_609338.1 | Gene: | CG13127 / 34335 | FlyBaseID: | FBgn0032176 | Length: | 734 | Species: | Drosophila melanogaster | 
| Alignment Length: | 770 | Identity: | 195/770 - (25%) | 
|---|---|---|---|
| Similarity: | 331/770 - (42%) | Gaps: | 150/770 - (19%) | 
- Green bases have known domain annotations that are detailed below.
| 
 
  Fly    12 WYTNLSDFQVQAVEALAFSIRDDNAEGTVYRTQFCLSRLGVTPMVKTRMLRKLIGICRGSDLAFL 76 
  Fly    77 YFLMEACYK-----GTGSAYS--------ERILMSAITFLDLEMTMRELDKILPPGVERLNKKES 128 
  Fly   129 IAPPVDYRSMSLPTPLPTKRESDLRKVRS------PYFTPLPKPK--LPKGGEKFTAKRPCLVVS 185 
  Fly   186 FPFWPAG-ERPNYKVNEENRWFAAYRFQPVKRMLFKMVGDIMTDYWTKIDGTQPAENEAMPMCEF 249 
  Fly   250 HKEALRQEQLVKDAAVVKAHKQCLALVDITSRQDALLKKRIVAQLERDIEEVTLRWKRLRERHHT 314 
  Fly   315 DVMLLEDHDQMCSVGKVPTAVQDIRIKY-------LSQEADIGRLSAKPTL--GIHVITGRGNVS 370 
  Fly   371 RLSKVRVSDPDD---DIPCPTVPVEQK----LAKCPPPILGHI-KRPRKVSITKSKFGD------ 421 
  Fly   422 -----DKQSSCKKPSKPG--------------RFFEAPHQH-SPFVFKYHAVAPQDQNPDTKDVI 466 
  Fly   467 RAQAIRTLKEQSCPSSEDNYNGRINPRDQVVAAIVECAQNMWFGSLEAHQRRLSSGQSERPTTIE 531 
  Fly   532 VPAKNEPEEICKTN-DALDWTKTIKKFDPNNQHLMERLLRDGFSVLRQDPRCVFAAFPDSHKSFV 595 
  Fly   596 MVEWIKRRYGKTYCHEEIVDTIEKGLATF--VHVENQLNEAP--SAKRE--GFSAKDTFDDFKRL 654 
  Fly   655 EALCKKLKTEYRMPLNDKILTLTRICWSALSPHLARSSSMLKTFFAYLPVRYADM 709  | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| ssp5 | NP_650149.1 | DUF4770 | 47..218 | CDD:292613 | 61/192 (32%) | 
| DUF4771 | 555..709 | CDD:292614 | 44/159 (28%) | ||
| CG13127 | NP_609338.1 | DUF4770 | 52..226 | CDD:292613 | 61/192 (32%) | 
| DUF4771 | 550..708 | CDD:292614 | 44/157 (28%) | 
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_2C9W7 | |
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 1 | 1.000 | - | - | FOG0009976 | |
| OrthoInspector | 1 | 1.000 | - | - | otm49876 | |
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | P | PTHR41967 | 
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 4 | 4.000 | |||||