DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tk and TAC1

DIOPT Version :8

Sequence 1:NP_001262493.1 Gene:Tk / 41456 FlyBaseID:FBgn0037976 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_003173.1 Gene:TAC1 / 6863 HGNCID:11517 Length:129 Species:Homo sapiens

Alignment Length:101 Identity:26/102 (25%)
Similarity:47/102 (46%) Gaps:22/102 (22%)


  Fly   129 EEERLRDSLLQDF---FDRVAGRDGSAVGKRAPTGFTGMRGKRPALLAGDDDAEADEAT------ 184
            :.:::::.|.:.|   ..|:|.|.       .|..|.|:.|||.|    |...|...|.      
Human    36 DSDQIKEELPEPFEHLLQRIARRP-------KPQQFFGLMGKRDA----DSSIEKQVALLKALYG 89

  Fly   185 --ELQQKRAPVNSFVGMRGKKDVSHQHYKRAALSDF 218
              ::..||...:||||:.||:.::...|:|:|:.::
Human    90 HGQISHKRHKTDSFVGLMGKRALNSVAYERSAMQNY 125



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
10.960

Return to query results.
Submit another query.