DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10005 and m

DIOPT Version :8

Sequence 1:NP_650137.3 Gene:CG10005 / 41451 FlyBaseID:FBgn0037972 Length:231 Species:Drosophila melanogaster
Sequence 2:NP_572747.1 Gene:m / 44835 FlyBaseID:FBgn0002577 Length:682 Species:Drosophila melanogaster

Alignment Length:142 Identity:38/143 (27%)
Similarity:62/143 (43%) Gaps:21/143 (15%)


  Fly    11 LFACNLLLAVHVSANKQQKNQNQEIWEQDLSDTFKIEGSDQGIQKVNLKCGADSMNVVLETEKPF 75
            :|..:|:.::.::.|        |:|..:..|..      ..|..:.:.||.|.|:|.|....||
  Fly    20 IFILHLMFSLVIAGN--------ELWPMERPDGM------PNIVSLEVMCGKDHMDVHLTFSHPF 70

  Fly    76 MGVMYTRGSFYKQSAP-CFMKPSSSQGSRTMEMNFQLDQCQTIRD--GDLYTNIVVIQNDPELIT 137
            .|::.::|   :.|.| |...|.|: |...........:|.|..|  |..|.|.||:|.|.:|:.
  Fly    71 EGIVSSKG---QHSDPRCVYVPPST-GKTFFSFRISYSRCGTKPDLNGQFYENTVVVQYDKDLLE 131

  Fly   138 PGDSAFSLECDF 149
            ..|.|..|.|::
  Fly   132 VWDEAKRLRCEW 143

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10005NP_650137.3 ZP 59..>162 CDD:214579 31/95 (33%)
mNP_572747.1 ZP 55..286 CDD:214579 31/94 (33%)
Zona_pellucida <194..287 CDD:278526
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C139553875
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR46560
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.