DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10005 and CG17111

DIOPT Version :8

Sequence 1:NP_650137.3 Gene:CG10005 / 41451 FlyBaseID:FBgn0037972 Length:231 Species:Drosophila melanogaster
Sequence 2:NP_651119.2 Gene:CG17111 / 42727 FlyBaseID:FBgn0039048 Length:792 Species:Drosophila melanogaster

Alignment Length:169 Identity:40/170 (24%)
Similarity:67/170 (39%) Gaps:35/170 (21%)


  Fly    56 VNLKCGADSMNVVLETEKPFMGVMYTRGSFYKQSAPCFMKPSSSQGS--RTMEMNFQL--DQCQT 116
            |.:.|..|.|.:....:..|:|.:|..    ..|..|..: .|..||  .|:::..::  ::|..
  Fly   350 VRVFCTRDEMTIKYNPKDWFVGKIYAS----MHSKDCLAR-GSGNGSVLLTLQIGSEVKENRCGI 409

  Fly   117 IRDGDL--------YTNIVVIQNDPELITPGDSAFSLECDFRQPRNLDVEASMQARDRVATGSKI 173
            :|..::        .:.:|||||:|.:.|.||....:.|   ...|......:..||     |.:
  Fly   410 LRAYEMTQEYQRTFISALVVIQNNPNVQTQGDRLIKVGC---IQSNATTSLGVSVRD-----SSV 466

  Fly   174 TLTSPDPAA--------PTEHL--HNSVVSNSDSVAYIP 202
            ..:.|.|:|        .|||:  |..||..:.|....|
  Fly   467 DSSEPVPSAIALESSLEYTEHMFPHEGVVHYNSSTGPHP 505

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10005NP_650137.3 ZP 59..>162 CDD:214579 25/115 (22%)
CG17111NP_651119.2 PAN_1 159..255 CDD:278453
PAN_AP_HGF 270..344 CDD:238532
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C139555045
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.