DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10005 and CG12814

DIOPT Version :8

Sequence 1:NP_650137.3 Gene:CG10005 / 41451 FlyBaseID:FBgn0037972 Length:231 Species:Drosophila melanogaster
Sequence 2:NP_001262454.1 Gene:CG12814 / 41246 FlyBaseID:FBgn0037796 Length:441 Species:Drosophila melanogaster

Alignment Length:144 Identity:30/145 (21%)
Similarity:53/145 (37%) Gaps:45/145 (31%)


  Fly    56 VNLKCGADSMNVVLETEKPFMGVMYTR------------GS---------FYKQSAP--CFMKPS 97
            |...|.|.:||:.::....:.|.::.|            ||         :.||.|.  |.:..|
  Fly    42 VTATCKAGTMNIKVKMSSGYTGAVHVRDYRTPGCMAMGDGSDQVAFSLNLWAKQGASDYCGILVS 106

  Fly    98 SSQGS-RTMEMNFQL------------DQCQTI--------RDGDLYTNIVVIQNDPEL-ITPGD 140
            :..|| ||.|.:.||            |:...|        ||.:.:..:..::||..: .|...
  Fly   107 NVSGSNRTEERSIQLAVRVHKTLELADDKFYVITCGKSGYARDDNAHVVLKFLENDHRVRETVYG 171

  Fly   141 SAFSLECDFRQPRN 154
            ..:.:..:|.:|.:
  Fly   172 HEYKIRAEFSKPND 185

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10005NP_650137.3 ZP 59..>162 CDD:214579 29/142 (20%)
CG12814NP_001262454.1 ZP 45..256 CDD:214579 29/142 (20%)
Zona_pellucida <181..256 CDD:278526 1/6 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C139554504
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR46560
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.