DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10005 and CG12814

DIOPT Version :10

Sequence 1:NP_650137.3 Gene:CG10005 / 41451 FlyBaseID:FBgn0037972 Length:231 Species:Drosophila melanogaster
Sequence 2:NP_001262454.1 Gene:CG12814 / 41246 FlyBaseID:FBgn0037796 Length:441 Species:Drosophila melanogaster


Alignment Length:144 Identity:30/144 - (20%)
Similarity:53/144 - (36%) Gaps:45/144 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 VNLKCGADSMNVVLETEKPFMGVMYTR------------GS---------FYKQSAP--CFMKPS 97
            |...|.|.:||:.::....:.|.::.|            ||         :.||.|.  |.:..|
  Fly    42 VTATCKAGTMNIKVKMSSGYTGAVHVRDYRTPGCMAMGDGSDQVAFSLNLWAKQGASDYCGILVS 106

  Fly    98 SSQGS-RTMEMNFQL------------DQCQTI--------RDGDLYTNIVVIQNDPEL-ITPGD 140
            :..|| ||.|.:.||            |:...|        ||.:.:..:..::||..: .|...
  Fly   107 NVSGSNRTEERSIQLAVRVHKTLELADDKFYVITCGKSGYARDDNAHVVLKFLENDHRVRETVYG 171

  Fly   141 SAFSLECDFRQPRN 154
            ..:.:..:|.:|.:
  Fly   172 HEYKIRAEFSKPND 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10005NP_650137.3 ZP 59..>162 CDD:214579 29/141 (21%)
CG12814NP_001262454.1 ZP 45..256 CDD:214579 29/141 (21%)

Return to query results.
Submit another query.