DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10005 and dy

DIOPT Version :8

Sequence 1:NP_650137.3 Gene:CG10005 / 41451 FlyBaseID:FBgn0037972 Length:231 Species:Drosophila melanogaster
Sequence 2:NP_511130.2 Gene:dy / 32130 FlyBaseID:FBgn0004511 Length:699 Species:Drosophila melanogaster

Alignment Length:209 Identity:50/210 (24%)
Similarity:75/210 (36%) Gaps:61/210 (29%)


  Fly    16 LLLAVHVSANKQQKNQ----------------------NQEIWEQDLSDTFKIEGSDQGIQKVNL 58
            |.|.|.....:||:.|                      |.|||...:.|..||...|       :
  Fly   196 LQLQVQPQQQQQQQQQHTQQQGQQQQVQVPDLSVGGSSNNEIWAAPVQDMPKIVSLD-------V 253

  Fly    59 KCGADSMNVVLETEKPFMGVMYTRGSFYKQSAPCFMKPSSSQGSRTMEMNFQLDQCQTIRDGDLY 123
            ||..:.|.|.::.:|||.|:::::|.:...:  |...| |..|..:...:..|.:|.|..:.|.|
  Fly   254 KCEKNGMKVFVQFDKPFNGIVFSKGHYSNMN--CVHLP-SGLGRSSASFDIGLHECGTAGNTDNY 315

  Fly   124 -----------------TNIVVIQNDPELITPGDSAFSLECDFRQPRN------------LDVEA 159
                             .||:|||.||::....|.|..|.|.:.....            |||..
  Fly   316 GQGYGHEAGSTGAGTYFENIIVIQYDPQVQEVWDQARKLRCTWHDQYEKSVTFRPFPVDMLDVVR 380

  Fly   160 SMQARDRVATGSKI 173
            :..|.|.|....:|
  Fly   381 ADFAGDNVGCWMQI 394

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10005NP_650137.3 ZP 59..>162 CDD:214579 32/132 (24%)
dyNP_511130.2 ZP 254..513 CDD:214579 36/145 (25%)
Zona_pellucida <403..510 CDD:278526
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C139553826
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR46560
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.