| Sequence 1: | NP_650137.3 | Gene: | CG10005 / 41451 | FlyBaseID: | FBgn0037972 | Length: | 231 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_510492.2 | Gene: | cutl-3 / 184721 | WormBaseID: | WBGene00008978 | Length: | 405 | Species: | Caenorhabditis elegans |
| Alignment Length: | 201 | Identity: | 42/201 - (20%) |
|---|---|---|---|
| Similarity: | 83/201 - (41%) | Gaps: | 25/201 - (12%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 44 FKIEGSDQGIQ-KVNLKCGADSMNVVLETEKPFMGVMYTRGSFYKQSAPCFMKPSSSQGSRTMEM 107
Fly 108 NFQL--DQCQTIRD------GDLYTNIVVIQNDPELITPGDSAFSLECDF-------RQPRNLDV 157
Fly 158 EASMQARDRVATGSKITLTSPDPAAPTEHLHN-SVVSNSDSVAY-IPKFSRPNRTIHLGSVEEVT 220
Fly 221 LPSSSQ 226 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG10005 | NP_650137.3 | ZP | 59..>162 | CDD:214579 | 25/117 (21%) |
| cutl-3 | NP_510492.2 | ZP | 33..306 | CDD:214579 | 38/185 (21%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 0 | 0.000 | |||||