DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10005 and cutl-24

DIOPT Version :8

Sequence 1:NP_650137.3 Gene:CG10005 / 41451 FlyBaseID:FBgn0037972 Length:231 Species:Drosophila melanogaster
Sequence 2:NP_001023450.1 Gene:cutl-24 / 176831 WormBaseID:WBGene00021396 Length:601 Species:Caenorhabditis elegans

Alignment Length:231 Identity:54/232 (23%)
Similarity:82/232 (35%) Gaps:62/232 (27%)


  Fly     5 MNGFLLLFACNLLLAVHVSANKQQKNQNQEIWEQDLSDTFKIEGSDQGIQKVNLKCGADSMNVVL 69
            |....|||..:|...           |||.:..|...           |:.|:..|.:|.:...:
 Worm     1 MKRSFLLFLLSLKFC-----------QNQYVTPQYAE-----------IRAVSAMCSSDGITASI 43

  Fly    70 ETEKPFMGVMYTRGSFYKQSAPC------------FMKPSSSQGS---RTMEMNFQLDQCQTIRD 119
            :.:|||.|.:|:..  |..|..|            |..||...|:   ||......:||.:    
 Worm    44 DFDKPFTGKIYSLN--YANSNDCLYYNNIDRDTVLFSIPSQLCGTKLQRTTRNVSMIDQME---- 102

  Fly   120 GDLYTNIVVIQNDPELITPGDSAFSLECDFRQPRNLDVEASMQARDRVATGSKITL----TSPDP 180
                 |.|.:|.|.:..|..|..||..|....|      ..|.|......|:|.:.    ..|..
 Worm   103 -----NRVYVQMDKDTQTSADKQFSFVCRLTDP------MKMAAAKDDGFGTKDSYQQAPIKPVA 156

  Fly   181 AAPTEHLHNSVVSNSDS-VAYIPKFSRPNRTIHLGS 215
            ::.:..:|:|::....| |..:..|||.:   |||:
 Worm   157 SSVSTKMHSSLMPIKPSEVRQVSAFSRDS---HLGN 189

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10005NP_650137.3 ZP 59..>162 CDD:214579 29/118 (25%)
cutl-24NP_001023450.1 Zona_pellucida <416..521 CDD:278526
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR46560
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.