DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10005 and cutl-20

DIOPT Version :8

Sequence 1:NP_650137.3 Gene:CG10005 / 41451 FlyBaseID:FBgn0037972 Length:231 Species:Drosophila melanogaster
Sequence 2:NP_490798.1 Gene:cutl-20 / 171678 WormBaseID:WBGene00018787 Length:360 Species:Caenorhabditis elegans

Alignment Length:233 Identity:43/234 (18%)
Similarity:75/234 (32%) Gaps:64/234 (27%)


  Fly    53 IQKVNLKCGADSMNVVLETEKPFMGVMYTRGSFYKQSAPCFMKPSSSQGSRTMEMNFQLDQCQTI 117
            |...::.|......:.::.::.|.|.:.:|....|    |.....:.|.....::...|..|.|.
 Worm    23 IVDTSIACDKTDFLLKIKFDENFRGTIQSRAGHPK----CIYANGTLQSDTKYQLKIPLTGCSTK 83

  Fly   118 R--DGDLYTNIVVIQNDPELITPGDSAFSLEC--------------------------------- 147
            .  :|:|...|.|:..:.|.....|..|.|.|                                 
 Worm    84 ENGEGNLENEIEVVMANNEFNAETDKRFLLTCIPAAPVPKESQVTVSFGGITINSDATTASSLSD 148

  Fly   148 ----DFRQPRNLDVEA--SMQARDRVATGSKITLT---SPD--------------PAAPTEHLHN 189
                |:| .|.||.::  |.|.:..:|.|.::|.|   |.|              ...|....|.
 Worm   149 NKTVDYR-VRVLDGDSLDSKQLQRPLAVGDRVTYTVEMSDDQNGRIGRCWANDGISELPLSDSHG 212

  Fly   190 SVVSNSDSVAYIPKFSRPN-RTIHLGSVEEVTLPSSSQ 226
            ..:..|..|....:.:|.| :||....::....|:|::
 Worm   213 CSLQTSGEVWGDFEVTRRNGKTIFYNHIKAWAFPTSNE 250

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10005NP_650137.3 ZP 59..>162 CDD:214579 25/144 (17%)
cutl-20NP_490798.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR46560
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.