DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tango9 and SLC35A2

DIOPT Version :10

Sequence 1:NP_650136.1 Gene:Tango9 / 41450 FlyBaseID:FBgn0260744 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_001269580.1 Gene:SLC35A2 / 7355 HGNCID:11022 Length:421 Species:Homo sapiens


Alignment Length:86 Identity:14/86 - (16%)
Similarity:29/86 - (33%) Gaps:28/86 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 YYCAGSDFSPAELSTLTDIQEHGYKLFVDILIAFPKPIIALVNGHAVGVSVTMLGVMDAVIAIDT 125
            ::|....|.|.|:|                       :..:.||..:...|...||:.:    ..
Human   104 FFCRAHGFYPPEIS-----------------------MTWMKNGEEIAQEVDYGGVLPS----GD 141

  Fly   126 ATFATPFADIGVCPEACSSYT 146
            .|:.| :..:.:.|::...|:
Human   142 GTYQT-WLSVNLDPQSNDVYS 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tango9NP_650136.1 None
SLC35A2NP_001269580.1 Nuc_sug_transp 59..367 CDD:398009 14/86 (16%)

Return to query results.
Submit another query.