DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12213 and RNF214

DIOPT Version :9

Sequence 1:NP_001097754.1 Gene:CG12213 / 41447 FlyBaseID:FBgn0260742 Length:581 Species:Drosophila melanogaster
Sequence 2:NP_001070707.1 Gene:RNF214 / 257160 HGNCID:25335 Length:703 Species:Homo sapiens


Alignment Length:400 Identity:91/400 - (22%)
Similarity:164/400 - (41%) Gaps:60/400 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 SQHQLDESRAFQEGLSVQMQSLNAEKLTAEKRMSALRSEKMTLQEQYEGQLAEALQKQHDTEH-- 96
            |..:|.::.|.|.........:|.:: ..||.:..:.:|:..|:|:|:    |.|.||...|:  
Human   195 SSLKLSQNIAVQTDFKTADSEVNTDQ-DIEKNLDKMMTERTLLKERYQ----EVLDKQRQVENQL 254

  Fly    97 -----ALQEKFDAQVEKYK--LLEIKYTNLEAEFVKSKKKHIEDTNAFDQKLQKVLADLHKDKAS 154
                 .||::.:.:::.::  |..|:...::.|  ::|||..::...|.||.|.:.|::.|....
Human   255 QVQLKQLQQRREEEMKNHQEILKAIQDVTIKRE--ETKKKIEKEKKEFLQKEQDLKAEIEKLCEK 317

  Fly   155 KEREVAAWKEKLDKLQ-RDGEHKIHALEATIAEFKTNC--------NYVPKVQPAEAPVQGHQQQ 210
            ..|||  |:.:||:|: :|||...:.:|.|...:|...        ..|.|::.||...:.|...
Human   318 GRREV--WEMELDRLKNQDGEINRNIMEETERAWKAEILSLESRKELLVLKLEEAEKEAELHLTY 380

  Fly   211 LNKPAEQMPTTHHSNPAQLAHS---IEKPRNEKSFDAQVQVSEGLYRIGGGVNLLATNPKQNL-- 270
            |......:.|.......:...:   |.|......|::.:|    |.|.|..::.|...|...|  
Human   381 LKSTPPTLETVRSKQEWETRLNGVRIMKKNVRDQFNSHIQ----LVRNGAKLSSLPQIPTPTLPP 441

  Fly   271 TNASTNFTLKSNGDGTQEQPQL-PLQPFAVSN-NHSLILNSVE----NFQIVPKSVSEKQQQEEP 329
            ..:.|:|.|:.    .|..|.| |..||::.. ...:::.|.:    :|.|:..::|:..|    
Human   442 PPSETDFMLQV----FQPSPSLAPRMPFSIGQVTMPMVMPSADPRSLSFPILNPALSQPSQ---- 498

  Fly   330 QLSGGPVSPLSAPRKSSTQASVGSASDKKAGDAPNASVAPK-----VSSSGLPPLAVPPAKTERK 389
                 |.|||......::.......|.......|.||:.|.     |.:|...|...|..|.|:.
Human   499 -----PSSPLPGSHGRNSPGLGSLVSPHGPHMPPAASIPPPPGLGGVKASAETPRPQPVDKLEKI 558

  Fly   390 LPENVAPIPE 399
            |.:.:...|:
Human   559 LEKLLTRFPQ 568

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12213NP_001097754.1 CCDC158 <33..>213 CDD:292543 49/196 (25%)
RNF214NP_001070707.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..59
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 104..134
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 146..197 1/1 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 486..552 16/74 (22%)
zf-RING_2 654..699 CDD:290367
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S8005
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.