DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12213 and Rnf214

Sequence 1:NP_001097754.1 Gene:CG12213 FlyBaseID:FBgn0260742 Length:581 Species:Drosophila melanogaster
Sequence 2:XP_011240798.1 Gene:Rnf214 MGIID:2444451 Length:703 Species:Mus musculus

Alignment Length:420 Identity:91/421 (22%)
Similarity:167/421 (40%) Gaps:100/421 (24%)


  Fly    34 SQHQLDESRAFQEGLSVQMQSLNAEKLTAEKRMSALRSEKMTLQEQYEGQLAEALQKQHDTE--- 95
            |..:|.::.|.|.........:|.:: ..||.:..:.:|:..|:|:|:    |.|.||...|   
Mouse   195 SSLKLSQNIAVQTDFKTADSEVNTDQ-DIEKNLDKMMTERTLLKERYQ----EVLDKQRQVESQL 254

  Fly    96 ----HALQEKFDAQVEKYK--LLEIKYTNLEAEFVKSKKKHIEDTNAFDQKLQKVLADLHKDKAS 154
                ..||::.:.:::.::  |..|:...::.|  ::|||..::...|.||.|.:.|::.|....
Mouse   255 QVQLKQLQQRREEEMKNHQEILKAIQDVTIKRE--ETKKKIEKEKKEFLQKEQDLKAEIEKLCEK 317

  Fly   155 KEREVAAWKEKLDKLQ-RDGEHKIHALEATIAEFKTNC--------NYVPKVQPAEAPVQGHQQQ 210
            ..|||  |:.:||:|: :|||...:.:|.|...:|...        ..|.|::.||         
Mouse   318 GRREV--WEMELDRLKNQDGEINRNIMEETERAWKAEILSLESRKELLVLKLEEAE--------- 371

  Fly   211 LNKPAEQMPTTHHSNPAQLAHSIEKPRNEKSFDAQVQVSEGLYRIGGGVNLLATNPKQNLTNAST 275
              |.||...|...|.|.    ::|..|:::.::.::          .||.::..|.:...   ::
Mouse   372 --KEAELHLTYLKSTPP----TLETVRSKQEWETRL----------NGVRIMKKNVRDQF---NS 417

  Fly   276 NFTLKSNGDGTQEQPQLP--------------LQ------------PFAVSN-NHSLILNSVE-- 311
            :..|..||......||:|              ||            ||::.. ...:::.|.:  
Mouse   418 HIQLVRNGAKLSSLPQIPTPTLPPPPSEADFMLQVFQPSPSLTPRMPFSIGQVTMPMVMPSADPR 482

  Fly   312 --NFQIVPKSVSEKQQQEEPQLSGGPVSPLSAPRKSSTQASVGSASDKKAGDAPNASVAPK---- 370
              :|.|:..::|:..|...|       .|.|..|.|....|:.|......  .|.||:.|.    
Mouse   483 SLSFPILNPALSQSSQPSPP-------LPGSHGRNSPGLGSLVSPHGPHM--PPAASIPPPPGLG 538

  Fly   371 -VSSSGLPPLAVPPAKTERKLPENVAPIPE 399
             :.:|...|...|..|.|:.|.:.:...|:
Mouse   539 GIKASSETPRPQPVDKLEKILEKLLTRFPQ 568

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12213NP_001097754.1 CCDC158 <33..>213 CDD:292543 47/197 (24%)
Rnf214XP_011240798.1 zf-RING_2 653..699 CDD:290367
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S8005
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.