DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14731 and CG9988

Sequence 1:NP_650130.1 Gene:CG14731 FlyBaseID:FBgn0037964 Length:641 Species:Drosophila melanogaster
Sequence 2:NP_651625.1 Gene:CG9988 FlyBaseID:FBgn0039591 Length:668 Species:Drosophila melanogaster

Alignment Length:702 Identity:173/703 (25%)
Similarity:292/703 (42%) Gaps:111/703 (16%)


  Fly     8 VEIKKNSFRLILMCII-LYVLINFREQVEHKMKEQPPIEGKPDNK------------------ML 53
            :.:.|...:.:..|:| :.|::..:.|..:.......:.|..|..                  ..
  Fly     2 ITLLKPIHKWLCFCLIAIIVILGIKTQNANTKPRVSEVTGSDDTNSDIPPAEEDRNVQDVVRPAY 66

  Fly    54 FVNSSQCQINSMDPFSPTAMYHMTPMPSSAC--------PMIKLMKPQSI----DGMNYLYLIAS 106
            ||.|::|:|..:|||:..||....|.....|        |:..:.:.:.:    :.:..:.|.::
  Fly    67 FVESAKCKIPYVDPFASDAMAIFHPEHFETCSNETALVTPIYDISRQRYVLFINESLASIILNSN 131

  Fly   107 AKE---LWKKLGVRRLSDIFCAYKR-FVRFNDFVNIYFESTLFRFSKLRNFTKVDSGNITLRVWC 167
            ..|   .::::...|..|.:...:| :...|..|.::.|..:....:|.|.:.:           
  Fly   132 GGEYNCYYQEITRDRKHDSYDKMERKYFSQNYEVPLHVEGLILTCHRLGNESDI----------- 185

  Fly   168 WMDYGRLVYHDVFIFLPFPNPQKVNNSAPVKRL-SVLILGIDSISHMHYQRYFSRVRDLIEGLPH 231
                   :..|.:..:.:..|.|..:..|.||. |||:.||||:|.::.:|...:|...:.....
  Fly   186 -------LQSDAYNLIQYRPPPKGLSLKPSKRKPSVLMFGIDSLSRINLRRTMPKVYKFLTRDGW 243

  Fly   232 TELWGYNRVGQNSYPNLIPLLSGQSVDEVEAK------SGCYGASGGTNFDRCHLLWHDFQAAGY 290
            .|..|||::|.|::|||:.:|:|.:.:....|      .||        .||...:||.|:.|.|
  Fly   244 FEQQGYNKIGDNTFPNLLAILTGYNPESAIKKVCNWHEDGC--------LDRTPFIWHYFRNASY 300

  Fly   291 ATIFGEDSRVAGTFTYVRPGFKKRPTDFYLRSVINEIHMRSTYFARGPLEIK-CSGDRVYHHVLY 354
            .|.:.||.....||.|.:|||.::|||||||.:...|......:......:| |.|.|:.....|
  Fly   301 LTAYAEDEAGINTFNYWKPGFLEQPTDFYLRPLQKAIESGLNTWKCSDCSMKYCIGRRITSSYAY 365

  Fly   355 DFIYRLLPHMQARMY------DRGFFAFFWQTMGVHDYFQYGERADWEYYRIMRALKRRKILERT 413
            |         .||.:      :|..:..||.....||.||...:.:....:.:...:...:.:::
  Fly   366 D---------MARNFANRFVDERPIWGLFWSNSFSHDSFQMPSKMEDYVLQYLLDFEADGVFDQS 421

  Fly   414 LVLIVSDHGLRYGPFVDTFQGMRETSLPIMVAIYPRSLRERFPLAFANLEANAHRLVTTYDLHET 478
            :::.:||||.|||..:....|..|..||.|....|...|.::|.....||.|.:||.:.||||.|
  Fly   422 IMVFLSDHGSRYGRLMSLPSGFLEERLPSMFIYLPPWFRAQYPEYARALELNRNRLTSNYDLHNT 486

  Fly   479 LKDVVDLENLSDERILNRTLRLRNNHNVSLFLPIPEERSCFSARIPLHYCQCDGYVKIPWNVRSI 543
            ||.:::|....|.:.|.:........  |||.|:.|.|||..|.||.|:|.|..|.::  :.:..
  Fly   487 LKHIIELGGTPDGQTLPKAADCPKCQ--SLFYPVDETRSCEDAGIPEHFCTCVPYKRL--DTQWA 547

  Fly   544 QRIAKLAVANINRLLAP---YPQCEQLEL-------------LNVEDAYLRKQHKLNKTIIVRLV 592
            :.||...:..||..||.   ...|.:|.|             .|..|...|.:....:|:   ..
  Fly   548 KSIAPKVIGRINEYLAGRNLSKICSELTLSYIHLTEMKVELDQNFHDDVPRAELGTYRTM---FK 609

  Fly   593 TQPGNGHFDATVLSKNET---SLQGP-ITRTDQYRHQSFCAREAPIEIYCYC 640
            .:..:..|.|||:..|.|   .::.| |:|.|.|.:.|.|.::...::||.|
  Fly   610 VKQNSADFRATVIFNNVTDSVEVEVPTISRLDSYENVSTCVKDKTDKMYCIC 661

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14731NP_650130.1 DUF229 77..573 CDD:281053 137/542 (25%)
ALP_like 200..485 CDD:293745 90/299 (30%)
CG9988NP_651625.1 DUF229 90..580 CDD:281053 136/529 (26%)
ALP_like 212..493 CDD:293745 90/298 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C49356
eggNOG 1 0.900 E1_28JJT
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10974
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.