DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14731 and CG15695

Sequence 1:NP_650130.1 Gene:CG14731 FlyBaseID:FBgn0037964 Length:641 Species:Drosophila melanogaster
Sequence 2:NP_650920.3 Gene:CG15695 FlyBaseID:FBgn0038832 Length:725 Species:Drosophila melanogaster

Alignment Length:626 Identity:172/627 (27%)
Similarity:273/627 (44%) Gaps:78/627 (12%)


  Fly    44 IEGKPDNKMLFVNSSQCQINSMDPFSPTAMYHMTPMPSSACPMIKLMKPQSIDGMNYLYLIASAK 108
            :||  :.|..||:|.|||::..:||:....:.........|.     |.:.:..:|| .:..|..
  Fly   149 LEG--NGKKYFVHSPQCQMSHPNPFANNIQHIYKKHSYIVCD-----KSRDMITVNY-NVTDSTY 205

  Fly   109 ELWKKLGVRRLSDIFCAYKRFVR-------------------FNDFVNIYFESTLFRFSKLRNFT 154
            .|.|.      .:..|.:|:.:|                   ..||:.....|.:..:.:...|.
  Fly   206 RLHKN------ENSTCCFKQILRAGTSANADHKYKLGPCVEFHQDFLVPTEVSAMITYCRRPPFD 264

  Fly   155 KVDSGNITLRVWCWMDYGRLVYHDVFIFLPFPNPQKVNNSAPVKRL-SVLILGIDSISHMHYQRY 218
            ||..                  .|.|.|:.....|..|.:.|.:|. |||:.||||||.|:.:..
  Fly   265 KVSQ------------------KDAFSFVHPRKDQIENPTTPHRRRPSVLLWGIDSISRMNLELT 311

  Fly   219 FSRVRDLIEGLPHTELWGYNRVGQNSYPNLIPLLSGQSVDEVEAKSGCYGASGGTNFDRCHLLWH 283
            ..|:.:.:......||.|||::|.|::|||:.:|:|  .::..|.:.|: .......|.|..:|.
  Fly   312 MPRMYEYLNNQHWFELQGYNKMGDNTFPNLMAVLTG--FNKTYANARCH-PEKVRGLDACPFIWK 373

  Fly   284 DFQAAGYATIFGEDSRVAGTFTYVRPGFKKRPTDFYLRSVINEIHMRSTYFARGPLEIKCSGDRV 348
            ||:..||.|.|.||.....||.|...||...|||.|.|.::..:....|...||.:.. |.|.:.
  Fly   374 DFKDKGYTTAFAEDWSKFSTFDYSSRGFFNPPTDVYGRPLVLAVEKELTILQRGQMPY-CLGRKP 437

  Fly   349 YHHVLYDFIYRLLPHMQARMYDRG--FFAFFWQTMGVHDYFQYGERADWEYYRIMRALKRRKILE 411
            ....:||.      .:|..|.:|.  ||..||.....|:.|......|....:.||.|.:..|::
  Fly   438 ASEYIYDM------GVQFTMVNRNSTFFGMFWTNTFSHNDFSMPSAMDERMVKYMRTLDKNGIMD 496

  Fly   412 RTLVLIVSDHGLRYGPFVDTFQGMRETSLPIMVAIYPRSLRERFPLAFANLEANAHRLVTTYDLH 476
            .|:::..||||.|:||..:...|..|..||.:....||.:||::|....||:.|.:||.:.||:|
  Fly   497 NTIIIFFSDHGSRFGPLRNLDSGFVEERLPFIYIRVPRWIREKYPKLLRNLQMNKNRLTSPYDIH 561

  Fly   477 ETLKDVVDLENLSDERILNRTLRLRNNHNVSLFLPIPEERSCFSARIPLHYCQCDGYVKIPWNVR 541
            .||:.:::|:...|:  |.|.....:.|  |:|..:...|:|..|.|..|:|.|:.:..:|....
  Fly   562 ATLRHILELDTPKDK--LPRPDGCSSCH--SVFEEVDWSRNCSQAGIEDHWCACNSFSDVPTTDP 622

  Fly   542 SIQRIAKLAVANINRLLAP---YPQCEQLELLNVEDAYLRKQHKLNKTIIVRLVTQPGNGHFDAT 603
            |.:.::...|..||..:|.   ..:|.:|:|..:.....|..   :...:::|:.|||:..|:||
  Fly   623 SARSMSTQLVEAINEYVASKKGTKRCSRLKLNRISSVQRRGN---SNRYLIQLMAQPGDALFEAT 684

  Fly   604 V---LSKNETSLQGP-ITRTDQYRHQSFCAREAPIEIYCYC 640
            |   .|......|.| |:|.|.|..:|.|:.....:.||.|
  Fly   685 VDWDASAQRIPAQMPSISRLDTYAAKSRCSSVKETKKYCIC 725

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14731NP_650130.1 DUF229 77..573 CDD:281053 140/521 (27%)
ALP_like 200..485 CDD:293745 94/288 (33%)
CG15695NP_650920.3 DUF229 180..656 CDD:281053 140/520 (27%)
ALP_like 293..571 CDD:293745 95/288 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C49460
eggNOG 1 0.900 E1_28JJT
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10974
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.