DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14731 and CG6236

Sequence 1:NP_650130.1 Gene:CG14731 FlyBaseID:FBgn0037964 Length:641 Species:Drosophila melanogaster
Sequence 2:NP_650446.2 Gene:CG6236 FlyBaseID:FBgn0038318 Length:680 Species:Drosophila melanogaster

Alignment Length:708 Identity:187/709 (26%)
Similarity:296/709 (42%) Gaps:134/709 (19%)


  Fly    21 CIILYVLINFREQVEHKMKEQPPIEGKPDNKMLFVNSSQCQINSMDPFSPTAMYHMTPMPSSACP 85
            |:::.::..:...||..:.:...||....:....||..:|:...:...:|..|....|:....|.
  Fly    17 CVVVLLVTWYVLNVERDLDKSLKIEIIERSIRSAVNRGECRHPHLPLDNPDIMKFYKPVERINCG 81

  Fly    86 MIKLMKPQSIDGMNYLYL----------IASAKELWKKLGVRRLSDIFCAYKRFVRFNDFVNIYF 140
                      :||:::..          |||:.|           |:.|:|...:|.:|:...:.
  Fly    82 ----------EGMDWVMCEKSICFVRPEIASSHE-----------DVICSYTDIIRKSDYKVRFG 125

  Fly   141 ESTLFR---FSKLRNFTKVDSGNITLRVWCWMDYGRLVYHDVFIFLPFPN--------------- 187
            :|...:   ..:..:|.||...:.:...|..|.:|   ..|.....|..|               
  Fly   126 QSLRMKEPYVLQASDFVKVVCRSSSGESWFGMAHG---IRDTVPRPPASNFSPNLAVLPPEAVAQ 187

  Fly   188 -PQKVNNSAPVKRLSVLILGIDSISHMHYQRYFSRVRD-LIEGLPHTELWGYNRVGQNSYPNLIP 250
             .|::.:.|.....:||:.|.||:|...:.|...|..: |.:.|..|.|.|||.||..:...|:|
  Fly   188 AQQQMQDGATAPIYNVLMFGFDSLSRNAFIRKLPRTYEYLTQQLGATVLKGYNIVGDGTPQALVP 252

  Fly   251 LLSGQSVDEVEAKSGCYGASGGTNFDRCHLLWHDFQAAGYATIFGEDSRVAGTFTYVRPGFKKRP 315
            ||:|  ..|:|........||..:.|...::|.||...||.|.|.||....|||||...||:.:|
  Fly   253 LLTG--FTELELPETRKRLSGAGSVDSYPMIWKDFARLGYMTSFNEDLPNVGTFTYRMTGFEAQP 315

  Fly   316 TDFYLRSVINEIHMRSTYFARG---PLEIK--CSGDRVYHHVLYDFI------YRLLPHMQARMY 369
            .|.|||          ||:.:.   ..|.|  |.|.:..|..:.::.      ||..|.      
  Fly   316 VDHYLR----------TYYVQAEHMAAESKPNCIGHQPDHITMLEYTKNFMLKYRDAPR------ 364

  Fly   370 DRGFFAFFWQTMGVHDYFQYGERADWEYYRIMRALKRRKILERTLVLIVSDHGLRYGPFVDTFQG 434
                |||.:.....||.......||.:.:..:.|||.|.:|:.|::::::|||.|:.....|.||
  Fly   365 ----FAFSFHGGLSHDSINLVGAADDDVHDWLVALKERSLLDDTILIMMADHGNRFAEVRATLQG 425

  Fly   435 MRETSLPIMVAIYPRSLRERFPLAFANLEANAHRLVTTYDLHETLKDVVDLENLSDE-RILN--- 495
            .:|..||....::|.|.::|||..:.|..||.|.|.|.:|:|.|||.|:.|:...|: ..:|   
  Fly   426 KQEERLPFFSFVFPESFKKRFPQEYKNFLANEHHLTTPFDIHATLKHVIQLQTAVDQFGEINDPK 490

  Fly   496 --------RTLRLRNNHNVSLFLPIPEERSCFSARIPLHYCQCDGYVKIPWN-VRSIQRIAKLAV 551
                    |...|.....:||..|||..|||..|.|..|:|.|..::.:..| .|....|.|.|.
  Fly   491 TETSPPGIRISELARGRAMSLLDPIPSNRSCADAYIEPHWCACLNWLPLQLNDSRYTGIILKAAQ 555

  Fly   552 ANINRL-LAPYPQ---CEQLELLNVEDAYLRKQHK------------------LNKTII------ 588
            :.:|.: ||...|   |..||:..|..|...:.||                  ..:|::      
  Fly   556 SIVNAINLATVEQRQYCAPLEIHRVNWALRLQPHKELLQFRTNSDRDGFLADMTGQTLVRDEMYQ 620

  Fly   589 VRLVTQPGNGHFDATVL----SKNETSLQGPITRTDQYRHQSFCA--REAPIEIYCYC 640
            :::||.||.|.|:|:|.    :.:.|:....|:|.::|.:|:.|.  |:..:..||||
  Fly   621 LQVVTMPGEGLFEASVAYSLHTFSATTKLTDISRVNKYGNQARCIYDRDPELRKYCYC 678

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14731NP_650130.1 DUF229 77..573 CDD:281053 154/554 (28%)
ALP_like 200..485 CDD:293745 98/297 (33%)
CG6236NP_650446.2 DUF229 73..581 CDD:281053 154/554 (28%)
ALP_like 201..477 CDD:293745 99/298 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_28JJT
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10974
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.