DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14731 and CG7120

Sequence 1:NP_650130.1 Gene:CG14731 FlyBaseID:FBgn0037964 Length:641 Species:Drosophila melanogaster
Sequence 2:NP_001246667.1 Gene:CG7120 FlyBaseID:FBgn0035888 Length:701 Species:Drosophila melanogaster

Alignment Length:705 Identity:181/706 (26%)
Similarity:297/706 (42%) Gaps:123/706 (17%)


  Fly     1 MGYSQCFVEIKKNSFRLILMCIIL----YVLINFREQVEHKMKEQPPIEGKPD-NKMLFVNSSQC 60
            :.::.|:..|.:..:..:|...:|    ||.:..:..| ..::.:|..|..|. .|...|.|:.|
  Fly    50 VSFTFCYFLIGRTGWVNVLDLDVLHSDNYVTVQHQSTV-MDVEPEPITETNPSVPKGFLVYSNSC 113

  Fly    61 QINSMDPFSPTAMYHMTPMPSSACPMIKLMKPQSIDGMNYLYLIASAKELWKKLGVRRLSDIFCA 125
            :|..:||:....|.|...:...:|..:..:.....:..:..||::.....:.:..|.:  .:.|.
  Fly   114 RIMEVDPYKNEVMRHFKRIKYKSCQKLTPLTQVKFEAKSQKYLLSIDGAAFGRYPVGK--QLHCC 176

  Fly   126 YKRFVRFNDFVNIYFESTLFRFSKLRN------FTKVDSGNITLRVWCWMDYGRLVYHDVFIFLP 184
            |....|.::....|.:...|:.|.|..      ..|.|||            ||.:|        
  Fly   177 YMSVQRVDEMKVKYTKCQTFKGSILLPDSAEGIIVKCDSG------------GRQIY-------- 221

  Fly   185 FPNPQKVNNSA--PVK-----RL---------------SVLILGIDSISHMHYQRYFSRVRDLIE 227
                  :|..|  |||     ||               |||:|||||||.:          :||.
  Fly   222 ------INGHATVPVKEAVQQRLRMASEADAKGYQRPPSVLMLGIDSISRV----------NLIR 270

  Fly   228 GLPHT----------ELWGYNRVGQNSYPNLIPLLSGQSVDEVEAKSGCYG-ASGGTNFDRCHLL 281
            .:|.|          ||.|||:|..|::||::.:|:|.::.  .|...|.. ..||  .|:|..:
  Fly   271 AMPKTAQYLYDNGWFELAGYNKVDDNTFPNIMAVLTGYNLP--NAMHACSPFVVGG--LDKCDYI 331

  Fly   282 WHDFQAAGYATIFGEDSRVAGTFTYVRPGFKKRPTDFYLRSVINEIHMRSTYFARGPLEIKCSG- 345
            |..:|..||.|.:.||:....||.|::.|||..|.|:|||..::....:..:.....| :.|.| 
  Fly   332 WKQYQQRGYVTAYAEDAVKINTFNYLKKGFKNPPADYYLRPYLSAAESQLDHTTVNGL-VHCLGY 395

  Fly   346 ----DRVYHHVLYDFIYRLLPHMQARMYDRGFFAFFWQTMGVHDYFQYGERADWEYY--RIMRAL 404
                :.||.:.| :|..|.|        :..:|.|||  ...|.:....:.:..:.|  ..:|.|
  Fly   396 LTAAEHVYDYGL-EFTRRFL--------NETYFGFFW--TNTHSHSDISQTSSMDSYMEEYLRKL 449

  Fly   405 KRRKILERTLVLIVSDHGLRYGPFVDTFQGMRETSLPIMVAIYPRSLRERFPLAFANLEANAHRL 469
            .|:..:|.|:|:..||||:|:||...|:.|..|..||.:....|:.||...|....:|:.|.:||
  Fly   450 VRQGTMENTVVVFFSDHGMRFGPTRATWSGHLEERLPAIFIWLPQHLRRSHPQFVRSLQLNRNRL 514

  Fly   470 VTTYDLHETLKDVVDLENLSDERILNRTLRLRNNHNVSLFLPIPEERSCFSARIPLHYCQCDGYV 534
            .|.||||.|:|.::.:...::...|..........  ||..|:..:|||....|..|:|.|..|.
  Fly   515 TTPYDLHLTMKHILAISGRAEMESLGPAPDCPQCQ--SLLTPVSPQRSCSDVGIADHWCTCWEYD 577

  Fly   535 KIPWNVRSIQRIAKLAVANINRLLAPYPQ------CEQLELLNVEDAYLRKQHKLN----KTIIV 589
            .|....:..:.:.|..|:.:|..:|.:..      |..|.|.:::.|:....:.|:    .|..:
  Fly   578 TISSTSKESRMLGKRVVSYLNNYVAEFRNGTFAKLCAPLSLHSIKSAFRAHHNALDPDEVHTYRL 642

  Fly   590 RLVTQPGNGHFDATVLSKNET----SLQGPITRTDQYRHQSFCAREAPIEIYCYC 640
            ..||.|..|.::|| |..|.|    .:.|.::|.:.|..::.|..:...:.||||
  Fly   643 IFVTSPNKGQYEAT-LRHNHTDDSVKVTGSVSRLNVYSGEADCMNDFAAKKYCYC 696

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14731NP_650130.1 DUF229 77..573 CDD:281053 142/548 (26%)
ALP_like 200..485 CDD:293745 98/318 (31%)
CG7120NP_001246667.1 DUF229 130..622 CDD:281053 142/548 (26%)
ALP_like 253..528 CDD:293745 97/301 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C49379
eggNOG 1 0.900 E1_28JJT
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10974
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.