DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14731 and CG1428

Sequence 1:NP_650130.1 Gene:CG14731 FlyBaseID:FBgn0037964 Length:641 Species:Drosophila melanogaster
Sequence 2:NP_610127.1 Gene:CG1428 FlyBaseID:FBgn0032967 Length:617 Species:Drosophila melanogaster

Alignment Length:657 Identity:225/658 (34%)
Similarity:346/658 (53%) Gaps:75/658 (11%)


  Fly    16 RLILMCIILYVL------INFREQVEHKMKEQPPIEGKPDNKMLFVNSSQCQINSMDPFSPTAMY 74
            ||:|...:..:|      :.|..|...:..|:..:...|: :::|||:|.|.::..  :.|||.|
  Fly     3 RLMLRMKVSMILTGVFFTLYFGLQPVTEWFERKDLVTAPE-EVVFVNTSVCHVSGQ--WKPTAFY 64

  Fly    75 H-MTPMPSSACPMIKLMKPQSIDGMNYLYLIASAKEL----WKKLG-VRRLSDIFCAYKRFVRFN 133
            . :.|:....|.|.:|:...:.||.|:|.....:::|    |.|.| .|..|..:.||..|    
  Fly    65 SAIEPVNKLRCRMTQLLTAITQDGSNFLEAKRISEDLSCRYWLKSGHTRNHSGHYTAYGHF---- 125

  Fly   134 DFVNIYFESTLFRFSKLRNFTKVDSGNITLRVWCWMDYGRLVYHDVFIFLPFPNPQKVNNSAPVK 198
                     .|.|.:..:  .|:.:|...:|:.|...:....||||..||..|:| |:.::...:
  Fly   126 ---------DLKRGATRK--IKIGTGEQIVRIRCSDKFKASKYHDVLYFLSPPDP-KLMSTESSE 178

  Fly   199 RLSVLILGIDSISHMHYQRYFSRVRDLIEGLPHTELWGYNRVGQNSYPNLIPLLSGQSVDEVEAK 263
            :|||::|||||:||||:.|||..|...:|..|||:.:||:|||.::..||:|.|.|:|       
  Fly   179 KLSVMVLGIDSVSHMHFVRYFPLVMAFLENHPHTKFFGYSRVGLDANANLVPFLGGKS------- 236

  Fly   264 SGCYGASGGTNF--DRCHLLWHDFQAAGYATIFGEDSRVAGTFTYVRPGFK---KRPTDFYLRSV 323
                ..:.|::.  |....||..|:..||:|.:|||:  |......|.|.|   |.|.||.|..|
  Fly   237 ----SRAAGSDILSDEKAWLWDSFKMEGYSTAYGEDN--AKGILSNRNGDKELPKSPVDFDLTPV 295

  Fly   324 INEIHMRSTYFARGPLEIKCSGDRVYHHVLYDFIYRLLPHMQARMYDRGFFAFFWQTMGVHDYFQ 388
            |.|::..:.|.......|.|:..|.:..||.||:.:|:|:||.    ..||:||||:.||.:|::
  Fly   296 IVEMNNHTRYSIDLKEMIHCTAGRKFQDVLRDFVLQLVPYMQG----MPFFSFFWQSQGVQEYYE 356

  Fly   389 YGERADWEYYRIMRALKRRKILERTLVLIVSDHGLRYGPFVDTFQGMRETSLPIMVAIYPRSLRE 453
            |....|..|..:::.|....||..||:.::||||||.|.:..:.|||:|.|.|:||||||..|:.
  Fly   357 YAWHLDLSYMMLLKKLLDADILNNTLLFLMSDHGLRAGEYRMSLQGMKEESQPLMVAIYPEWLKR 421

  Fly   454 RFPLAFANLEANAHRLVTTYDLHETLKDVVDLENLSDERILNRTLRLRNN------HNVSLFLPI 512
            ::|||..|||:|||.|:|.|||.|||.||:.|..|.|..|.....||:::      ..:||||||
  Fly   422 KYPLAVGNLESNAHSLITPYDLRETLADVIALGQLKDANIEVSMKRLQSHPPNRLPRGISLFLPI 486

  Fly   513 PEERSCFSARIPLHYCQCDGYVKIPWNVRSIQRIAKLAVANINRLLAPYPQCEQLELLNV----- 572
            |:.|:|..|.||..:|.|....::|.:...:.|.::..|.:||:|:.|:.||.||:|..|     
  Fly   487 PDHRTCDLAHIPSLFCFCRELTEVPTDDGLVLRSSRFMVESINQLIKPFGQCRQLKLEMVLLAHF 551

  Fly   573 ----EDAYLRKQHKLNKTIIVRLVTQPGNGHFDATVLSKNETSLQGPITRTDQYRHQSFCAREAP 633
                |::::.:       :.:|:.|.||||.::|||...:...|..||:|...|..||.|..:..
  Fly   552 LDFGEESFVYE-------LRLRVRTSPGNGVYEATVRLSDVLLLTSPISRVSHYLGQSHCIGDPD 609

  Fly   634 IEIYCYC 640
            ::|:|.|
  Fly   610 LQIFCLC 616

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14731NP_650130.1 DUF229 77..573 CDD:281053 187/521 (36%)
ALP_like 200..485 CDD:293745 122/290 (42%)
CG1428NP_610127.1 DUF229 68..547 CDD:281053 187/512 (37%)
ALP_like 180..453 CDD:293745 122/290 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C130873623
eggNOG 1 0.900 E1_28JJT
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D306348at33208
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10974
RoundUp 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.