DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14731 and CG11630

Sequence 1:NP_650130.1 Gene:CG14731 FlyBaseID:FBgn0037964 Length:641 Species:Drosophila melanogaster
Sequence 2:NP_610124.1 Gene:CG11630 FlyBaseID:FBgn0032964 Length:631 Species:Drosophila melanogaster

Alignment Length:678 Identity:220/679 (32%)
Similarity:331/679 (49%) Gaps:99/679 (15%)


  Fly     6 CFVEIKKNSFRLILMCIILY---VLINFREQVEHKMKEQPPIEGKPDNKMLFVNSSQCQINSMDP 67
            ||:      :.||:...:.|   |:::.....||.:.|:..::.|           .|::.:|.|
  Fly     9 CFL------YSLIIFSFVYYYNDVVVDNIIFEEHHLVEKYSVDTK-----------GCRMLTMVP 56

  Fly    68 FSPTAMYHMTPMPSSACPMIKLMKPQSIDGMNYLYLIASAK-ELWK-KLGVRRLSDIFCAYKRFV 130
            .....|:....:....|  ...:...|.....|.||..... ||.| :.||..|....|.|....
  Fly    57 NEYDVMFLWRGLRRDFC--ASNLNLTSFSNCTYNYLRTEVNMELAKARFGVETLESFKCMYYAME 119

  Fly   131 RFNDFVNIYFESTLFRFSKLRNFTKVDSGNIT-------LRVWCWMDYGRLVYHDVFIF------ 182
            |..||.|.|..|        |.|..:..||.|       :|..|::: ...:|:.|..:      
  Fly   120 RHTDFDNRYLYS--------REFELLTDGNNTIEPHADIIRAECFIN-ATSIYNGVHFYVHPTDE 175

  Fly   183 -------LPFPNPQKVNNSAPVKRLSVLILGIDSISHMHYQRYFSRVRDLIEGLPHTELWGYNRV 240
                   ||   |.|:  ::.|..|||||:|:||||.||:.|..:|..:.:..|||.||.|:||:
  Fly   176 WLRTAQGLP---PLKL--ASDVGSLSVLIVGLDSISQMHFHRSMARTANFLLSLPHVELKGFNRL 235

  Fly   241 GQNSYPNLIPLLSGQSVDEVEAKSGCYGASGGTNFDRCHLLWHDFQAAGYATIFGEDSRVAGTFT 305
            |::.:.:|:|||||.|..|::..|     |..::.|.|..:|..||.|||.|..|||:.....|.
  Fly   236 GEDGFDSLMPLLSGLSGQELKDVS-----SNLSSLDSCPFIWKVFQKAGYETGLGEDNIDKSLFV 295

  Fly   306 YVRPGFKKRPTDFYLRSVINEIHMRSTYFARGPLEIKCSGDRVYHHVLYDFIYRLLPHMQARMYD 370
               .||:|.|||||||..:.|:.:::.  ..|.....|:....|..||.:|::::|||..:..  
  Fly   296 ---KGFRKPPTDFYLRPALLEMWLKTR--TDGLFGTHCNEKDNYAMVLREFLFKMLPHHTSHR-- 353

  Fly   371 RGFFAFFWQTMGVHDYFQYGERADWEYYRIMRALKRRKILERTLVLIVSDHGLRYGPFVDTFQGM 435
              ||.|.|.|.|:...|.||.:.|..:.::.:|:.|..:|:.|::|:||:|||..|.|..|.||.
  Fly   354 --FFTFLWWTQGIDHLFNYGRKLDQPFLKMFKAIGRSGLLKNTVLLVVSNHGLNKGRFYKTVQGK 416

  Fly   436 RETSLPIMVAIYPRSLRERFPLAFANLEANAHRLVTTYDLHETLKDVVDLENLSDERILNRTLRL 500
            .|.|.|:.:..|||.|.||:|.|..||::|..||||.:|||.||:::.:|.:|.||::..|.:.|
  Fly   417 VEESQPLAILCYPRWLEERYPQAIGNLKSNNRRLVTAFDLHATLQNLPNLTSLEDEQLQQRRVDL 481

  Fly   501 -----RNNHNVSLFLPIPEERSCFSARIPLHYCQC---------DGYVKIPWNVRSIQRIAKLAV 551
                 .....:|||||||:.|.||.|.||...|.|         ||||         ||.|:|.:
  Fly   482 WAMGKDIPRGISLFLPIPDHRDCFLAAIPTANCLCQQPRNVSTSDGYV---------QRAARLII 537

  Fly   552 ANINRLLAPY-PQCEQLELLNV--EDAYLRKQHKLNKTIIVRLVTQPGNGHFDATV-LSKNETSL 612
            .|:|:::..: |.|:.|.|..|  .|.:.|...:......|||:..||.|.|:..| .:..:.::
  Fly   538 RNLNKMIHTHTPPCKTLYLDRVLTADKWRRIADEHQSEFRVRLIATPGEGQFEGIVRYTGYKLAV 602

  Fly   613 QGPITRTDQYRHQSFCAREAPIEIYCYC 640
            .|.|:|.:.||:.|.|.|...||:||:|
  Fly   603 DGHISRVNDYRNGSQCIRNYLIEMYCFC 630

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14731NP_650130.1 DUF229 77..573 CDD:281053 183/535 (34%)
ALP_like 200..485 CDD:293745 114/285 (40%)
CG11630NP_610124.1 DUF229 66..560 CDD:281053 183/533 (34%)
ALP_like 195..467 CDD:293745 115/286 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C130873769
eggNOG 1 0.900 E1_28JJT
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D306348at33208
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10974
RoundUp 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.