DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14731 and CG10730

Sequence 1:NP_650130.1 Gene:CG14731 FlyBaseID:FBgn0037964 Length:641 Species:Drosophila melanogaster
Sequence 2:NP_610021.3 Gene:CG10730 FlyBaseID:FBgn0032843 Length:644 Species:Drosophila melanogaster

Alignment Length:674 Identity:171/675 (25%)
Similarity:287/675 (43%) Gaps:83/675 (12%)


  Fly    10 IKKNSFRLILMCIILYVLINFREQVEHKMKEQPPIEGKPDNKMLFVNSSQCQINSMDPFSPTAMY 74
            :.:..|:.:|      ::|.|...:|:.      ::|..|   .:|.|..||:.:::||:...|.
  Fly     3 LSRKDFQALL------IVICFGFWIENL------VQGADD---YYVYSPVCQMPAVNPFTWDTMS 52

  Fly    75 HMTPMPSSACPMIKLMKPQSIDGMNYLYLIASAKELWKKLGVRR-LSDIFCAYKRFVRFNDFV-- 136
            :........|.....|.....|...:.|.:...:.|.|.:..|: .:.:.|.|:...|.|...  
  Fly    53 NFHRKTLRHCHNDSDMVTSEFDFETHQYRLHVHEHLAKPIMNRKGNATLECEYQEISRDNSDQKP 117

  Fly   137 -NIYFESTLFRFSKLRNFTKVDSGNITLRVWCWM----DYGRLVYHDVFIFLPFPNPQK-----V 191
             |.|.:   .|...:.....|.:....:...|::    .:..|:..|...|:....|::     |
  Fly   118 DNAYNQ---LRRRPIEQHQFVPNNTDYMITSCYVRDVTKHRELLQQDAISFIEDRLPKEKVKDFV 179

  Fly   192 NNSAPVKRLSVLILGIDSISHMHYQRYFSRVRDLIEGLPHTELWGYNRVGQNSYPNLIPLLSGQS 256
            .:.:.|.:.||||:|:||.|.::.:|....|...:......|:.|||:||.|::|||:..|:|.|
  Fly   180 KDESEVHKPSVLIMGLDSTSRINLRRAMPSVYKFVRQPGWFEMQGYNKVGDNTFPNLLAALTGDS 244

  Fly   257 VDEV-----EAKSGCYGASGGTNFDRCHLLWHDFQAAGYATIFGEDSRVAGTFTYVRPGFKKRPT 316
            ...|     ..|.||        .|..:.:|..|:.|.|.|.|.||.....||.|::|||.|:||
  Fly   245 EKGVGDYCDVTKPGC--------LDSLNFIWKRFKKANYTTAFAEDCSSISTFNYLKPGFVKQPT 301

  Fly   317 DFYLRSVINEIHMRSTY-----FARGPLEIKCSGDRVYHHVLYDFIYRLLPHMQARMYDRGFFAF 376
            |:|||.::..|..:...     ||      .|.|..:....::||..:.:.....|   ...|.|
  Fly   302 DYYLRPLLFAIEKQFKVTNDFGFA------YCVGRHLSFSYVWDFGQQFIDRFLGR---SPMFGF 357

  Fly   377 FWQTMGVHDYFQYGERAD---WEYYRIMRALKRRKILERTLVLIVSDHGLRYGPFVDTFQGMRET 438
            .|.....|||::.....|   |:|   :::.:...:.::::|:::||||.||........|..|.
  Fly   358 LWSNSFTHDYYEGATALDNLLWKY---LKSFEESNLFQKSIVILMSDHGHRYNTLRRASTGYFEE 419

  Fly   439 SLPIMVAIYPRSLRERFPLAFANLEANAHRLVTTYDLHETLKDVVDLENLSDERILNRTLRLRNN 503
            .:|:|....|...|.::|...:||..|.:||.:.||::.||:.::.|::.|.:...: .||.|..
  Fly   420 RMPMMFIYLPPWFRRKYPHLASNLGKNQNRLSSNYDVYMTLQHLLQLDSKSVDEFPD-NLRARQC 483

  Fly   504 HNV-SLFLPIPEERSCFSARIPLHYCQCDGYVKIPWNVRSIQRIAKLAVANINRLLAPY---PQC 564
            .:. |||..:|..|:|..|.|...:|.|.....|. |...:..||:..|..:|..|..:   ..|
  Fly   484 KSCQSLFFELPFNRTCQMAGIEEKWCCCQPTETIT-NSPHVSTIAEAIVQRMNEHLISHNLSDLC 547

  Fly   565 EQLELLNVEDA--------YLRKQHKLNKTIIVRLVTQPGNGHFDATVL--SKNETSLQ---GPI 616
            ....|..||.|        .||...|..:..|:...|.|.|..|:|||.  |:.:..|.   ..:
  Fly   548 HNFTLDYVEKADRKTILSNGLRPADKNEQVYIIVFETVPKNPIFEATVRWNSRTQRLLHFDVEEL 612

  Fly   617 TRTDQYRHQSFCAREAPIEIYCYC 640
            :|...|::.:.|......:.||.|
  Fly   613 SRLTSYKNDANCINRKNAKKYCIC 636

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14731NP_650130.1 DUF229 77..573 CDD:281053 136/526 (26%)
ALP_like 200..485 CDD:293745 89/298 (30%)
CG10730NP_610021.3 DUF229 55..556 CDD:281053 136/526 (26%)
ALP_like 188..467 CDD:293745 90/299 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C49304
eggNOG 1 0.900 E1_28JJT
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10974
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.