DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14731 and CG16854

Sequence 1:NP_650130.1 Gene:CG14731 FlyBaseID:FBgn0037964 Length:641 Species:Drosophila melanogaster
Sequence 2:NP_001245974.1 Gene:CG16854 FlyBaseID:FBgn0032338 Length:705 Species:Drosophila melanogaster

Alignment Length:671 Identity:215/672 (32%)
Similarity:337/672 (50%) Gaps:55/672 (8%)


  Fly     9 EIKKNSFRLILMCIILYV---------LINFREQVEHKMKEQPPIEGKPDNKMLFVNSSQCQINS 64
            :.||....:..:|:..|:         |:.||:..:...:.:....|.. ....||:::.|::..
  Fly    49 QFKKVVIVIFALCVFSYLCVDYNLRTKLLRFRDGFDFMARIEDHYGGNV-TTAYFVDTTGCRMPH 112

  Fly    65 MDPFSPT-AMYHMTPMPSSACPMIKLMKPQSIDGMNYLYLIASAKELWKKLGVRRLSDIFCAYKR 128
            .:....| |.:...|.|.| |....:....:|.|.  |:|...|.||.....:..||.:.|.|..
  Fly   113 FEVSDDTIAQFIFKPRPYS-CNRALIRTSDTIPGQ--LHLNLEASELLAYYNISDLSSVNCNYTE 174

  Fly   129 FVRFNDFVNIYFESTLFRFSKLRNFTKVDSGNITLRVWCWMDYGRLVYHDVFIFL---PFPNPQK 190
            ..|..|..|.:..:..|:..|:   .|:...:..:.:||:....:|.|.|...|.   |...|..
  Fly   175 VKRKTDSSNTHSPAVSFKLDKV---MKLPLSSEFICMWCYDSLDKLFYKDCHFFAVDKPRIRPPL 236

  Fly   191 VNNSAPV---------KRLSVLILGIDSISHMHYQRYFSRVRDLI-EGLPHTELWGYNRVGQNSY 245
            ...:..|         :||||:|||:||:||:::.|...|..:.: :.|.|.|.||||:||.|::
  Fly   237 KTGTDRVSFNKSKEEQERLSVMILGMDSLSHLNFLRQMRRTANYVRKHLSHVEFWGYNKVGDNTF 301

  Fly   246 PNLIPLLSGQSVDEVEAKSGCYGASGGTNFDRCHLLWHDFQAAGYATIFGEDSRVAGTFTYVRPG 310
            |||:|||||  :|:.|....|...: ..::|||..:|..:|..||.:||.||..:...|.|.:.|
  Fly   302 PNLVPLLSG--LDDQELNLACTPKT-LRSYDRCSFIWKRYQQLGYRSIFAEDVAMLSAFNYNQNG 363

  Fly   311 FKKRPTDFYLRSVINEIHMRSTYFARGPLEIK-CSGDRVYHHVLYDFIYRLLPHMQARMYDRGFF 374
            |:|:|||:|||.:|.|  |..|...:..|.:. |.|.|....||.:::.:|:|.|...:|    |
  Fly   364 FRKQPTDYYLRPMIME--MEKTVAFKKDLNMHLCMGSRRTADVLLEYMKKLVPRMSRDLY----F 422

  Fly   375 AFFWQTMGVHDYFQYGERADWEYYRIMRALKRRKILERTLVLIVSDHGLRYGPFVDTFQGMRETS 439
            :|||.....||||.:....|....:.:..|:...:|.||:|:::||||||:|.|..|:|||.|..
  Fly   423 SFFWTVALTHDYFNFPSLLDEAMLQQLMQLQDSGLLNRTVVMLLSDHGLRWGSFRRTYQGMMEER 487

  Fly   440 LPIMVAIYPRSLRERFPLAFANLEANAHRLVTTYDLHETLKDVVDLENLSDERILNRTLRLRN-- 502
            .|:|:.:||..:.||:|.|.|||..||.||.|.:|:|.|:..:::|.||..:::..|:..:..  
  Fly   488 QPLMMLLYPPWMTERYPEAIANLRLNARRLTTPFDVHATMLQLLNLHNLEADQLQRRSTEMDEPD 552

  Fly   503 ---NHNVSLFLPIPEERSCFSARIPLHYCQCDGYVKIPWNVRSIQRIAKLAVANINRLLAPYPQC 564
               ...:|||||||..|:|..|.|..|:|.|....::..|...:||.|:..|..||..|....||
  Fly   553 STLPRGISLFLPIPAARTCEQAGIAAHWCTCHQRQELQTNDPRVQRAARYLVRLINNRLKDSSQC 617

  Fly   565 EQLELLNVEDAYLRKQH-KLNKT--------IIVRLVTQPGNGHFDATV-LSKNETSLQGPITRT 619
            ..|.|.::..|.:...| |:.|.        |.:||.|:||.|.|::|| ::...|.|.|.|:|.
  Fly   618 RTLYLNSILQALIAAPHSKIVKNISTDYAVDITLRLQTKPGLGVFESTVRMTGYTTVLTGTISRL 682

  Fly   620 DQYRHQSFCAREAPIEIYCYC 640
            :.|..||:|..:..::::|||
  Fly   683 NLYGSQSYCLNDPALKMFCYC 703

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14731NP_650130.1 DUF229 77..573 CDD:281053 176/515 (34%)
ALP_like 200..485 CDD:293745 115/287 (40%)
CG16854NP_001245974.1 DUF229 126..626 CDD:281053 176/515 (34%)
ALP_like 255..533 CDD:293745 115/287 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C130873899
eggNOG 1 0.900 E1_28JJT
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D306348at33208
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10974
RoundUp 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.