DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14731 and CG18088

Sequence 1:NP_650130.1 Gene:CG14731 FlyBaseID:FBgn0037964 Length:641 Species:Drosophila melanogaster
Sequence 2:NP_001260271.1 Gene:CG18088 FlyBaseID:FBgn0032082 Length:663 Species:Drosophila melanogaster

Alignment Length:727 Identity:169/728 (23%)
Similarity:291/728 (40%) Gaps:181/728 (25%)


  Fly    15 FRLILMCIILYVLI------NFREQVEHKMKEQPP------IEGKPDNKMLFVNSSQCQINSMDP 67
            ::.:.:|..|.:::      |......|.:  .||      :..|.:.:..||.:|:|.|..:||
  Fly    12 YKFLALCCFLTIVLFLIYSSNTSSNTNHDL--YPPTTRFSRVSVKAEPQKFFVKTSKCHIPYVDP 74

  Fly    68 FSPTAMYHMTPMPSSACPMIKLMKPQSIDGMNYLYLIASAKELWKKLGVRRLSDIFCAYKRFVRF 132
            |:..||              :|.|||:        ||..:.|          :|:..     ..:
  Fly    75 FNDEAM--------------ELYKPQT--------LITCSNE----------TDLIS-----TTY 102

  Fly   133 NDFVN---IYFESTLFRFSKLRNFTKVDSGNITLRVWCW---MDYGRL----------------- 174
            |:.:.   ::.:..:.:  ||.|||..|..       |:   :.||::                 
  Fly   103 NEIIKRHILHIDDEVAQ--KLLNFTDKDYN-------CFYREIKYGKIADTYDNLKAKKYFTSGY 158

  Fly   175 ----------------------VYHDVFIFLPF-PNPQKVNNSAPVKRLSVLILGIDSISHMHYQ 216
                                  :..|.|.|:.. |.|:........::.||::.||||:|.::.:
  Fly   159 EVPVHVEGMIVECQTADDPIVVLQKDAFAFIQHRPLPKDSIRPRAARKPSVIMYGIDSLSRINLR 223

  Fly   217 RYFSRVRDLIEGLPHTELWGYNRVGQNSYPNLIPLLSGQSVDEVEA------KSGCYGASGGTNF 275
            |...:|.:.::|....|:.|||:|..||:||::.:|||.|....:.      |.||        .
  Fly   224 RTMPKVFNFLQGPGWYEMQGYNKVADNSFPNILAILSGYSASTAKENVCDTDKQGC--------L 280

  Fly   276 DRCHLLWHDFQAAGYATIFGEDSRVAGTFTYVRPGFKKRPTDFYLRSVINEIHMRSTYFARGPLE 340
            |...::|..|:.|.|.|.:.||...:..|.|::|||.|:|.|:|.|.::..:......:.....:
  Fly   281 DEMPMIWKYFKNASYLTGYAEDESNSNHFNYLKPGFSKKPMDYYFRPLLRALESEMDVYRLPEHD 345

  Fly   341 IK--CSGDRVYHHVLYDFIYRLLPHMQARMYDRGFFAFFWQTMGVHDYFQYGERADWEYYRIMRA 403
            ..  |.|.|:.:..:||:   .|...:..::||..:..||.....||            ...|.:
  Fly   346 YMRYCLGRRIANRYIYDY---GLQFTKRFVHDRPIWGMFWSNHFSHD------------DPFMPS 395

  Fly   404 LKRRKIL------------ERTLVLIVSDHGLRYGPFVDTFQGMRETSLPIMVAIYPRSLRERFP 456
            ..:.|:|            |..:::..:|||.|:|......:|..|..||:|....|...||.:|
  Fly   396 AMQEKVLGDLIDMHADGQFEEMIMIFFADHGTRFGDLTYLKEGFLEERLPMMFIYLPPWFRETYP 460

  Fly   457 LAFANLEANAHRLVTTYDLHETLKDVVDLENLSDERILNRTLRLRNNHNVSLFLPIPEERSCFSA 521
            .....||.|.|||.:.:|||.|||.::::....|.|.|.::.......  |||.|:||.|:|..|
  Fly   461 SYVRALELNQHRLSSNFDLHNTLKHIIEIGGTPDGRELPKSFDCPTCQ--SLFYPLPEGRTCSEA 523

  Fly   522 RIPLHYCQCDGYVKI---PWNVRSIQRIAKLAVANINRLLAPYPQ------CEQLELLNVEDAYL 577
            .|..|:|.|:.|..|   .|.       ..:|.:.|:|:...:.|      |..|.|..|....:
  Fly   524 GIEEHWCTCEPYKIISGQDWT-------TPIAHSVIDRMNEYFVQKNLTSLCSNLTLNYVHKTEI 581

  Fly   578 RKQHKL--NKTII--------VRLVTQPGNGHFDATVLSKNETSLQ----GPITRTDQYRHQSFC 628
            :....:  ::|::        ::...:..:..|.|||:..|.|...    ..|:||:.|:..|.|
  Fly   582 KTGLNIDWHQTLMESETAVYRIKFKVKQNSADFQATVVYHNSTQNAQVNVEKISRTNSYKEDSTC 646

  Fly   629 AREAPIEIYCYC 640
            ..:...::||.|
  Fly   647 IDDKLAKLYCIC 658

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14731NP_650130.1 DUF229 77..573 CDD:281053 136/571 (24%)
ALP_like 200..485 CDD:293745 86/305 (28%)
CG18088NP_001260271.1 DUF229 84..577 CDD:281053 135/557 (24%)
ALP_like 207..489 CDD:293745 86/305 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C49564
eggNOG 1 0.900 E1_28JJT
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10974
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.