DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14731 and CG9525

Sequence 1:NP_650130.1 Gene:CG14731 FlyBaseID:FBgn0037964 Length:641 Species:Drosophila melanogaster
Sequence 2:NP_609260.1 Gene:CG9525 FlyBaseID:FBgn0032080 Length:678 Species:Drosophila melanogaster

Alignment Length:653 Identity:153/654 (23%)
Similarity:256/654 (39%) Gaps:123/654 (19%)


  Fly    29 NFREQVEHKMKEQPPIEGKPDNK----MLFVNS--SQCQINSMDPFSPTAMYHMTPMPSSACPMI 87
            |.::|.....|::..|..:.|.|    :|:||.  :|.::.||...||                 
  Fly    58 NIKKQHTICSKDESLINLRFDEKSHQYLLYVNDHVAQLKLRSMKKKSP----------------- 105

  Fly    88 KLMKPQSIDGMNYLYLIASAKELWKKLGVRRLSD---IFCAY--KRFVRFNDFVNIYFESTLFRF 147
                  ::.|.|..|     :|| |:|....:.|   ::..|  .|.::|.|         .|.:
  Fly   106 ------NLIGYNCSY-----REL-KRLNRDYIVDAPVVYVCYLTDRSLKFED---------QFLY 149

  Fly   148 SKLRNFTKVDSGNIT------LRVWCWMDYGRLVYHDVFIFLPFPNPQKVNNSAPV---KRL-SV 202
            | |....|..:|.|.      :|..|..:....:..|.|:.:     |.....||:   .|: :|
  Fly   150 S-LGEEVKFWNGYIVPPSVEGMRATCRNELAEDLQSDTFVLV-----QPPKTYAPLISWHRIPNV 208

  Fly   203 LILGIDSISHMHYQRYFSRVRDLIEGLPHTELWGYNRVGQNSYPNLIPLLSGQS---VDEVEAKS 264
            |::|.|.||.::::|.|..|.:.::......:.||..:|:|:..||:..|:|.|   :..::..|
  Fly   209 LLIGFDGISQINFRRNFPLVFNQLKMQDWFRMDGYTGIGENTQSNLMASLTGYSPHTLMNLKCDS 273

  Fly   265 GCYGASGGTNFDRCHLLWHDFQAAGYATIFGEDSRVAGTFTYVRPGFKKRPTDFYLRSVINEIHM 329
            ...|.     .....|:|..|:..|:.|.:||.  ::..|...:.|..:...|||.|    ..::
  Fly   274 SVIGC-----LKTVPLIWKHFKKKGFITAYGEG--ISNLFDSEKYGIFEGTIDFYAR----HKNL 327

  Fly   330 RSTYFARGPLEIKCSGDR--VYHHVLYDFIYRLLP-HMQARMYDRGFFAFFWQTMGVHDYFQYGE 391
            :|           |...|  :.|:  ||:....|. |...   :|.||..|:.. |:.:......
  Fly   328 QS-----------CIDRRFNIKHN--YDYCEEFLKRHANT---NRPFFGVFFGN-GITNRSYDNA 375

  Fly   392 RADWEYYRIMRALKRRKILERTLVLIVSDHGLRYGPFVDTFQGMRETSLPIMVAIYPRSLRERFP 456
            |...|....::..|:..||.:::|::.|   .......:......:..|||:....|...:...|
  Fly   376 RIQTELLDKVKKFKKMGILTQSIVVLFS---YPVSSVKEKKTNFSQEDLPILYIWLPPWFKAFRP 437

  Fly   457 LAFANLEANAHRLVTTYDLHETLKDVVDL----ENLSDERILNRTLRLRNNHNVSLFLPIPEERS 517
            .....|..|:.||.:.||||.||:.:::|    ....|:.:...|.:       :||.|:||.|:
  Fly   438 EIVQALRINSKRLTSPYDLHLTLQHLLELGERWPRAVDKLVDCPTCQ-------TLFAPVPENRT 495

  Fly   518 CFSARIPLHYCQCDGYVKIPWNVRSIQRIAKLAVANINRLLAP---YPQCEQLELLNVEDAYLRK 579
            |..|.|....|.||.|..:..|......:.|..|.:||..|..   :..|..|.|.:|:....||
  Fly   496 CSDAGIGESQCPCDSYKLLSSNQMKQLSVGKQIVRSINEFLNHHNLHELCHNLTLKSVKMVLQRK 560

  Fly   580 QHKLN--KTIIVRLVTQPGNGHFDATV-LSKNETSLQ----GPITRTDQYRHQSFCAREAPIEIY 637
            ..||:  .|........|.|..|..|: .:.|...|:    ..|.|.:.|::.|.|.|......:
  Fly   561 DRKLSSGSTYRAYFSANPNNAEFSTTIRYANNRQELEYINVESINRLNNYQNDSSCMRRLRGRKF 625

  Fly   638 CYC 640
            |.|
  Fly   626 CIC 628

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14731NP_650130.1 DUF229 77..573 CDD:281053 120/524 (23%)
ALP_like 200..485 CDD:293745 68/292 (23%)
CG9525NP_609260.1 DUF229 66..554 CDD:281053 132/570 (23%)
ALP_like 206..466 CDD:293745 68/291 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C49411
eggNOG 1 0.900 E1_28JJT
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10974
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.