DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14731 and CG3123

Sequence 1:NP_650130.1 Gene:CG14731 FlyBaseID:FBgn0037964 Length:641 Species:Drosophila melanogaster
Sequence 2:NP_608716.1 Gene:CG3123 FlyBaseID:FBgn0031465 Length:634 Species:Drosophila melanogaster

Alignment Length:642 Identity:280/643 (44%)
Similarity:396/643 (62%) Gaps:34/643 (5%)


  Fly    13 NSFRLILMCIILYVLINFREQVEHKMKEQPPIEGKPDNKMLFVNSSQCQINSMDPFSPTAMYHMT 77
            |.|.|.::|.::...::.|.:. ..::|.|.|....::: ||||::.|:|::..|.|..|:..|.
  Fly    12 NIFLLAVLCYLILTSLSDRNKT-ISIREVPQIYINEEDE-LFVNTTGCRISATKPLSLYALSFME 74

  Fly    78 PMPSSACPMIKLMKPQSIDGMNYLYLIASAKELWKKLGVRRLSDIFCAYKRFVRFNDFVNIYFES 142
            |:....|.|.:||..::|...|||....|      :.|:.....:.|.|:.|||.:|..|.|...
  Fly    75 PIEPVLCRMEQLMVAETIGDRNYLVRNIS------RHGILSWRQVSCIYREFVRVDDAHNKYISL 133

  Fly   143 TLFRFSKLRNFTKVDSGNITLRVWCWMDYGRLVYHDVFIFLPFPNPQKVNNSA--PVKRLSVLIL 205
            ..|:.:....:.:|.:|...:|.|||:|:||:::|||..||| |.||..|.|.  ..::|||:||
  Fly   134 KFFKLTDRTRYLEVGTGLQHIRTWCWVDFGRIIFHDVMYFLP-PLPQATNRSTEHQKRKLSVMIL 197

  Fly   206 GIDSISHMHYQRYFSRVRDLIEGLPHTELWGYNRVGQNSYPNLIPLLSGQSVDEVEAKSGCYGAS 270
            |:||||||||.|||.||.|.||.|||||.||||||..|:|||||||:||.||.|:||  .||  .
  Fly   198 GVDSISHMHYMRYFHRVADFIEHLPHTEFWGYNRVALNTYPNLIPLVSGLSVSEMEA--SCY--H 258

  Fly   271 GGTNFDRCHLLWHDFQAAGYATIFGEDSRVAGTFTYVRPGFKKRPTDFYLRSVINEIHMRSTYFA 335
            ...|||:|:.||::|:.|||:|||.||:..||.|.|.:.||:|:|||.|:|.::.||...|.|  
  Fly   259 DELNFDKCNFLWNEFKRAGYSTIFAEDTDTAGLFIYRKRGFQKQPTDIYMRPLMTEIESHSLY-- 321

  Fly   336 RGPLEIKCSGDRVYHHVLYDFIYRLLPHMQARMYDRGFFAFFWQTMGVHDYFQYGERADWEYYRI 400
            |...::||:|.|:|....|||:.:|:|||:.::    ||:|.|...|:||.|.|.:..|.:|..|
  Fly   322 RTTFDLKCTGHRLYGEFYYDFVSKLIPHMERQL----FFSFLWNMHGIHDVFPYAKFVDKDYLSI 382

  Fly   401 MRALKRRKILERTLVLIVSDHGLRYGPFVDTFQGMRETSLPIMVAIYPRSLRERFPLAFANLEAN 465
            :..|..:.::|.||:|.:.|||||:..|..|..|..|.|.|:::||||..|:.|||||.:|.|.|
  Fly   383 LTRLHEKGVMENTLILFMGDHGLRFDKFARTAPGQHEMSQPLLIAIYPEWLKRRFPLAMSNFERN 447

  Fly   466 AHRLVTTYDLHETLKDVVDLENLSDERILNRTLRLRNNHNVSLFLPIPEERSCFSARIPLHYCQC 530
            |..|:||:|||||||||:.|:.|:|..:.||||.|.|...:|||||||:.|:|.:|.|..|||.|
  Fly   448 ARSLITTFDLHETLKDVIHLDRLTDANVRNRTLYLTNERGISLFLPIPQNRNCKTAEIKQHYCLC 512

  Fly   531 DGYVKIPWNVRSIQRIAKLAVANINRLLAPYPQCEQLELLNVEDAY------LRKQHKLNKTIIV 589
            :....:..:..:||..|..||..||.|:.|||||..|.|.:|..||      .|..::::: ::|
  Fly   513 NELKSVSTHESAIQEAASFAVDRINELIKPYPQCRVLSLQSVRTAYRAKSSTYRGNYRVSQ-VMV 576

  Fly   590 RLVTQPGNGHFDATVL------SKNETSLQGPITRTDQYRHQSFCAREAPIEIYCYC 640
            ||.|.||:|:||||||      .|.:..|.||:||||:|.||::|.:...||:||||
  Fly   577 RLKTTPGDGNFDATVLITMLNGEKTDMKLGGPVTRTDRYAHQAYCVQNYRIEMYCYC 633

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14731NP_650130.1 DUF229 77..573 CDD:281053 228/498 (46%)
ALP_like 200..485 CDD:293745 148/285 (52%)
CG3123NP_608716.1 DUF229 74..555 CDD:281053 228/498 (46%)
ALP_like 192..468 CDD:293745 149/286 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C130873550
eggNOG 1 0.900 E1_28JJT
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D306348at33208
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10974
RoundUp 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.