DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14731 and CG32985

Sequence 1:NP_650130.1 Gene:CG14731 FlyBaseID:FBgn0037964 Length:641 Species:Drosophila melanogaster
Sequence 2:NP_788013.2 Gene:CG32985 FlyBaseID:FBgn0052985 Length:644 Species:Drosophila melanogaster

Alignment Length:675 Identity:173/676 (26%)
Similarity:297/676 (44%) Gaps:95/676 (14%)


  Fly    14 SFRLILMCIILYVLI------NFREQVEHKMKEQPPIEGKPDNKMLFVNSSQCQINSMDPFSPTA 72
            ||:.:::..:...||      :.|.......::...:|     |:.:|.|.:|::..::||:...
  Fly     8 SFKRLIVSFLAVTLICLWSMNSSRVDENFSARDSQEVE-----KLFYVESGKCKMRYVNPFNAEF 67

  Fly    73 MYHMTPMPSSACPMIKLMKPQSIDGMNYLYLIASAKELWKKLGVRRLSDIFCAYKRFVRFNDFVN 137
            :....|.....|.....:.....|.:...|::.:.:|:..:|...:.:|..|.|::.        
  Fly    68 LKINHPKAFIPCTNESDLISVHYDKILNQYVLHTNEEVLHELSESKTNDFACFYQKI-------- 124

  Fly   138 IYFESTLFRFSKLRNFTKVDSGNIT------LRVWC-WMDYGRLVYHDVFIFLPFPNPQKVNNSA 195
            ||.:|......|... ||:...::.      :.|.| ..|..|::..|.|:|:.:.:|.:  |..
  Fly   125 IYGQSAEHYDGKGVK-TKISQNHLVPLDVEGMLVECRTADEMRVLQRDAFVFVQYKDPPQ--NVK 186

  Fly   196 PVKRLSVLILGIDSISHMHYQRYFSRVRDLIEGLPHTELWGYNRVGQNSYPNLIPLLSGQSVDEV 260
            |||:.||::.|||::|..:.:|....|.:.::.....|:.|||:|..||:||:..:|:|.|.:..
  Fly   187 PVKKASVIMYGIDTVSRTNLRRMMPMVFEFLKSPGWYEMMGYNKVADNSFPNIFAMLTGFSPESA 251

  Fly   261 EAK------SGCYGASGGTNFDRCHLLWHDFQAAGYATIFGEDSRVAGTFTYVRPGFKKRPTDFY 319
            |.:      .||        .|:...:|.||:..||.|.:.||...:.||.|.:|||..:|||:|
  Fly   252 ETQICNTDVDGC--------LDKIPFIWKDFKKDGYLTAYAEDEEHSNTFNYAKPGFAVKPTDYY 308

  Fly   320 LRSVINEIHMRSTY--FARGPLEIKCSGDRVYHHVLYDFIYRLLPHMQARMYDRGFFAFFWQTMG 382
            .|..:..:. ..|:  :..|.:...|.|.|:....::|:..:.   ||..:.||..:..||....
  Fly   309 FRPFLTALE-NETFIQYCPGCVMKYCLGRRLASSYIFDYCRQF---MQRFVADRPIWGMFWTNHY 369

  Fly   383 VHDYFQYGERADWEYYRIMRALKRRKILERTLVLIVSDHGLRYGPFVDTFQGMRETSLPIMVAIY 447
            .||..........:....:.:.::..:.|.|:::..||||.|:||.:.|.:...|..||:|....
  Fly   370 SHDDLFMLSAMQHKILEDLLSFEKDGVFEHTIMIFFSDHGARFGPLMYTKEAFLEERLPMMFIYL 434

  Fly   448 PRSLRERFPLAFANLEANAHRLVTTYDLHETLKDVVDLENLSDERILNRTLRLRNNHNV----SL 508
            |...|:::|.....|..|.:||.:.:||:.|||.::::|.|.::        .:.:::.    ||
  Fly   435 PPWFRKKYPRYVEALAQNQNRLSSNFDLYNTLKHIINIEGLVED--------TKWSYDCPQCQSL 491

  Fly   509 FLPIPEERSCFSARIPLHYCQCDGYVKI-----PWNVRSIQRIAKLAVANINRLLAPY---PQCE 565
            |.|:||.|||..|.||..||.|..|.:|     .|      |:|.|.|..:|:.|..:   ..|.
  Fly   492 FYPLPESRSCSEAAIPEAYCTCHNYEEIKEDQGTW------RLANLVVDRMNKYLHYHNLQNLCS 550

  Fly   566 QLELLNVEDAYLRKQHKLNKTIIVRLVTQPGNGH-----------FDATVLSKNET-SLQ---GP 615
            .|.|..:....:|...|     .|.|.....:.|           |.||||...:| .||   ..
  Fly   551 NLTLRVINSTEVRMDDK-----DVDLANGMRHYHTKFQVHQNLAEFFATVLYDKQTEELQMNVEL 610

  Fly   616 ITRTDQYRHQSFCAREAPIEIYCYC 640
            |:||:.|...|.|......::||.|
  Fly   611 ISRTNMYGTDSECVNNKIQKLYCVC 635

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14731NP_650130.1 DUF229 77..573 CDD:281053 139/523 (27%)
ALP_like 200..485 CDD:293745 83/293 (28%)
CG32985NP_788013.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C49327
eggNOG 1 0.900 E1_28JJT
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10974
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.