DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14731 and CG31933

Sequence 1:NP_650130.1 Gene:CG14731 FlyBaseID:FBgn0037964 Length:641 Species:Drosophila melanogaster
Sequence 2:NP_722734.1 Gene:CG31933 FlyBaseID:FBgn0051933 Length:673 Species:Drosophila melanogaster

Alignment Length:699 Identity:220/700 (31%)
Similarity:332/700 (47%) Gaps:98/700 (14%)


  Fly    12 KNSFR-----LILMCIILYVLINFREQVEHKMKEQPPIEGKPDNKMLFVNSSQCQINSMDPFSPT 71
            :.|||     :||..||||.|:....|...       ..||..| ..|||:..|:|.:||..:||
  Fly     3 ERSFRKLVLGVILTTIILYALLFLDTQCYE-------TGGKIHN-AFFVNTDGCRIIAMDVMNPT 59

  Fly    72 -AMYHMTPMPSS----ACPMIKLMKPQSIDGMNYLYLIASAKELWKKLGVRRLSDIFCAYKRF-V 130
             |.|........    .||.....:.:..:|..||.|......:.::..:.....|.|.:.|. :
  Fly    60 IAKYTDWEWKDKRFYLKCPHQTWFRTEVANGDWYLKLTRDIDRILQESDLTHDWQIKCYWFRIKI 124

  Fly   131 RFNDFVNIYFESTLFRFSKLRNFTKVDSGNITLRVWCWMDYGRLVYHDVFIFLPFPNPQKV---- 191
            :......|| ..|:|.. :.....||..|...:||.|...:.....||...|...|.|:|:    
  Fly   125 KGRWRAKIY-GPTMFPL-EYPYALKVPKGLRHMRVKCLNTFTNKTLHDDAHFFIQPPPEKLLKKP 187

  Fly   192 -----------NNSAPVKRLSVLILGIDSISHMHYQRYFSR-VRDLIEGLPHTELWGYNRVGQNS 244
                       ::|.....:||:|||:||:||::..|...| ||.:.:.:...|.||:|::|.|:
  Fly   188 PATLKYWDGEKHSSGATSPISVMILGLDSVSHLNLLRQMPRTVRYMRQNMSQVEFWGFNKIGTNT 252

  Fly   245 YPNLIPLLSGQSVDEVEA---KSGCYGASGGTNFDRCHLLWHDFQAAGYATIFGEDSRVAGTFTY 306
            |||||.||:|.|..|.||   :..|        .|...|:|.:|:.|||.|.|.||..:...|.:
  Fly   253 YPNLIALLTGLSAAESEAYWVRQKC--------MDNLPLIWKEFKRAGYNTSFAEDMAIYSMFYF 309

  Fly   307 VRPGFKKRPTDFYLRSVINEIH--MRSTYFARGPLEIK---CSGDRVYHHVLYDFIYRLLPHMQA 366
            .:||||:..||       |.:|  |...|..|....:.   |.|:|.:..:|.:...|||||.| 
  Fly   310 GKPGFKRPTTD-------NNLHDFMVDLYINRQASSVSDTHCMGERAFMDILLEMNDRLLPHTQ- 366

  Fly   367 RMYDRGFFAFFWQTMGVHDYFQYGERADWEYYRIMRALKRRKILERTLVLIVSDHGLRYGPFVDT 431
             .|.  ||:|:|...|.|::|.....||..:.|::|:|....|...|::..:||||||:|.|..:
  Fly   367 -RYP--FFSFYWWANGFHEFFNSPRLADGRFERLLRSLDDAGITNNTIIFFMSDHGLRWGLFRSS 428

  Fly   432 FQGMRETSLPIMVAIYPRSLRERFPLAFANLEANAHRLVTTYDLHETLKDVVDLENLSDERILNR 496
            ||||.|.|.|.:..:||:.:|.::|:|..:|..|||.||||||||||||.:::..:|.|..|..:
  Fly   429 FQGMIEDSQPFLSVLYPKWMRLKYPMAIKSLVGNAHSLVTTYDLHETLKHILEPSSLEDTSITQK 493

  Fly   497 TLRL------RNNHNVSLFLPIPEERSCFSARIPLHYCQCDGYVKIPWNVRSIQRIAKLAVANIN 555
            |..|      :....||||||||..|:|.::.||..:|.|...:.||.:.|.:.:.|.:.:..:|
  Fly   494 TEELWKLKGSQTPRAVSLFLPIPPWRNCNTSHIPSKFCLCHKQIPIPESNRVVTKSASIIIDYVN 558

  Fly   556 RLLAPYPQCEQLELLNVEDAYL--------------------------RKQHKLNKTIIVRLVTQ 594
            :|:..||.|..|:|.::|.||.                          :||...::.|:|||.|:
  Fly   559 QLMVEYPVCIPLQLDSIESAYFAAPQRDDDFYIEKGHKNVYPEKGPFWKKQKYEDRDIVVRLKTK 623

  Fly   595 PGNGHFDA-TVLSKNETSLQGPITRT-DQYRHQSFCAREAPIEIYCYCS 641
            |||.:|:. |....::.||.|.:.|. .:....:.|.....:|.:|:|:
  Fly   624 PGNAYFEGMTRRQGSKLSLVGEVVRVGGEGNRNNDCIDNPLLEPFCHCA 672

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14731NP_650130.1 DUF229 77..573 CDD:281053 172/531 (32%)
ALP_like 200..485 CDD:293745 116/294 (39%)
CG31933NP_722734.1 DUF229 114..576 CDD:281053 166/483 (34%)
ALP_like 208..483 CDD:293745 116/294 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C130873694
eggNOG 1 0.900 E1_28JJT
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D306348at33208
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10974
RoundUp 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.