DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14731 and T23E1.1

Sequence 1:NP_650130.1 Gene:CG14731 FlyBaseID:FBgn0037964 Length:641 Species:Drosophila melanogaster
Sequence 2:NP_001343691.1 Gene:T23E1.1 WormBaseID:WBGene00020728 Length:603 Species:Caenorhabditis elegans

Alignment Length:586 Identity:127/587 (22%)
Similarity:202/587 (34%) Gaps:154/587 (26%)


  Fly    18 ILMCIILYVLI-NFREQVEHKMKEQPPIEGKPDNKMLFVNS-SQCQ---INSMDPFSPTAMYHMT 77
            |:.||..::.| |:|  |....:|...:|  |.|...|.|. .|.:   .||..|:    |.|  
 Worm    13 IIFCIGFWIQISNYR--VRAHRREFESVE--PFNNFKFFNEIGQVEDENENSCYPY----MVH-- 67

  Fly    78 PMPSSACPMIKLMKPQSI-------------DGMNYLYLIASAKELWKKLGVRRLSDIFCAYKRF 129
               |....::.|:.|...             ||     ::..::.:::|....:..:..|.|...
 Worm    68 ---SIEADILGLISPMIFSCNSPMGNWANFSDG-----ILTISERIFEKRKAEQNQNFTCVYAEI 124

  Fly   130 VRFNDFVNIYFESTLFRFSKLRN------FTKVDSGNITLRVWCWMDYGRLVYHDVFI-FLPFPN 187
            |...:..|   .:.|...|||..      .||::|....  |:|...:|...|:..|. ||  |.
 Worm   125 VPKTELPN---GTILAEASKLETPIEPGIPTKIESEQFV--VFCRDPFGNHFYNKTFFNFL--PR 182

  Fly   188 PQKVNNSAPVKRLSVLILGIDSISHMHYQRYFSRVRDLIEGLPHTELWGYNRVGQNSYPNLIPLL 252
            .:.:.|.:.... |::||.|..:||....|:..|...............:|:..|::..|.:...
 Worm   183 SETLTNLSSSDE-SLMILSISGMSHNQAMRHLKRSLKFAADNEFQSFSMFNQRSQDNLENSLKTF 246

  Fly   253 SG-QSVDEVEAKSGC----------YGASGGTNFDRCHLLWHDFQ-----------AAGYATIFG 295
            .| :.|..:...:||          :....|..||....|:..|.           :.|..|:  
 Worm   247 GGSEKVWNIAKNNGCPTFLNTDSPKFSKMYGYQFDYHSNLYSSFNKQYLGQVDNCISDGSVTV-- 309

  Fly   296 EDSRVAGTFTYVRPGFKKRPTDFYLRSVINEIHMRSTYFAR--GPLEIKCSG-DRVYHHVLYDFI 357
            ||:....             |:|.|....|..|....:|..  ||.:.|... |.|.::.|    
 Worm   310 EDAITLW-------------TNFSLTFHPNLCHFSLLHFTEVAGPGDGKIVNIDEVLNNSL---- 357

  Fly   358 YRLLPHMQARMYDRGFFAFFWQTMGVHDYFQYGERADWEYYRIMRALKRRKILERTLVLIVSDHG 422
             .:|                 |:.||                          |..|.|:|:||.|
 Worm   358 -EIL-----------------QSFGV--------------------------LHNTTVVILSDGG 378

  Fly   423 LRYGPFVDTFQGMRETSLPIMVAIYPRSLRERFPLAFANLEANAHRLVTTYDLHETLKDVVDLEN 487
            .......:|..|..|:...:.:.....|.|:|||.....|:.|..||:|..|:.||||.::..:|
 Worm   379 TGNSTIFETETGKLESRYGVFLIRLSDSYRKRFPENAEILKKNVDRLITNQDVAETLKHIIYDQN 443

  Fly   488 LSDERILNRTLRLRNNHNVSLFLPIPEERSCFSARIPLHYCQCD-----GYVKIPWNVRSIQRIA 547
            ..:....|..|...|:          :.|||..|.|...:|.|.     |..|.|..:|::.:|.
 Worm   444 QENVTFENSLLSRENS----------KSRSCDIAGIEDEFCICSKLAQIGIDKRPEILRNLLKIV 498

  Fly   548 K 548
            |
 Worm   499 K 499

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14731NP_650130.1 DUF229 77..573 CDD:281053 108/523 (21%)
ALP_like 200..485 CDD:293745 65/310 (21%)
T23E1.1NP_001343691.1 DUF229 108..500 CDD:308570 103/474 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_28JJT
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10974
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.