DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14731 and T07G12.3

Sequence 1:NP_650130.1 Gene:CG14731 FlyBaseID:FBgn0037964 Length:641 Species:Drosophila melanogaster
Sequence 2:NP_501945.2 Gene:T07G12.3 WormBaseID:WBGene00011594 Length:623 Species:Caenorhabditis elegans

Alignment Length:685 Identity:167/686 (24%)
Similarity:260/686 (38%) Gaps:198/686 (29%)


  Fly    47 KPDNKMLFVNSSQCQINSMDPFSPTAMYHMTPMPSSACPMIKLMKPQSIDGMNYLYLIASAKELW 111
            |.::|.|:::||:...|                 ..|.|:             |.|...|.|.:.
 Worm    31 KIESKFLYLDSSRSAHN-----------------ICALPI-------------YDYWDTSIKNVM 65

  Fly   112 KKLGVRRLSDIFCAYKRFVRFNDFVNIYFESTLFRFSK------LRNFTKV-DSGNITLRVW--- 166
            .:....|     ..||.:|::.:.||     :.:|..|      .|.|:.: .|.|:.:..|   
 Worm    66 HEYNPAR-----NCYKNYVQWTELVN-----STWRIVKDGANCLARCFSGIGGSKNVKIGPWMKP 120

  Fly   167 -----------CWMD----YGRLVYHDVFIFLPFPNPQKVN----NSAPVKRLSVLILGIDSISH 212
                       ||.|    ||.:  |...|      |:|.:    ..||    :|.|..||:::.
 Worm   121 GHVDCEFLETVCWEDNIEVYGHI--HTQII------PRKASPTKFKDAP----NVFIFTIDAMNT 173

  Fly   213 MHYQR-------YFSRVRDLIEGLPHTELWGYNRVGQNSYPNLIPLLSGQSV--------DEVEA 262
            ...:|       ||.....:|| .|..     |:||:||.||.:||..|:|:        |:||.
 Worm   174 GMAKRSFPKLLSYFKNEFQMIE-FPFV-----NKVGENSRPNGLPLWFGKSIEGGRRVTGDDVEV 232

  Fly   263 ----KSGCYGASGGTNFDRCHLLWHDFQAAGYATIFGED--SRVAGTF-TYVRPGFKKRPTDFYL 320
                ...|     .|..|....::.||:..||||:..||  ..|..:: |.|  ||::.|||...
 Worm   233 DWDWNQYC-----ETYLDNSSHIFKDFKDHGYATMLFEDWEGNVVDSWPTCV--GFEEPPTDHTF 290

  Fly   321 R--SVINEIHMRSTYFARGPLEI---KCSGD--RVYHHVLYDFIYRLLPHMQARMYDRGFFAFFW 378
            |  :.::|.|         .:||   ..||.  |..||.    |..||........||..|::.|
 Worm   291 RPFASVSETH---------GMEITKRHLSGKFCRETHHA----IMELLEQGIEAYKDRPIFSWLW 342

  Fly   379 QTMGVHDYFQYGERADWEYYRIMRALKRRKILERTLVLIVSDHGLRYGPFVDTFQGMRETSLPIM 443
            .....||:.....|.|  .|.:....|...:.:.:.|:.|||||||.|..:.|..|..|...|.:
 Worm   343 LAWVAHDWIDGAARVD--EYLVNYFKKHNNMFDNSFVMFVSDHGLRTGKHMRTEIGAFERDNPFL 405

  Fly   444 VAIYPRSLR-ERFPLAFANLEANAHRLVTTYDLHETLKDVVDLE-----------NLSDERILNR 496
            ....|:..| .:|.: ...|..::.:|.|.:|:..||.|::..:           |:.||:    
 Worm   406 SISIPKRFRATKFGI-LETLNFDSKQLQTHFDVRATLLDILKFQPTSKFMDRQQKNIPDEK---- 465

  Fly   497 TLRLRNNHNVSLFLPIPE-ERSCFSARIPLHYCQC--DGY------VKIPWNVRSIQRI-AKLAV 551
                  .|  ||....|: .|:|.:..||..:|.|  |.:      :|.....:.:..: .||..
 Worm   466 ------GH--SLIRKQPDFPRTCATLPIPQQWCICQVDKFEIHNETLKNHLGEKLLNHVHRKLKK 522

  Fly   552 ANINRLLAPYPQCEQLELLNV----EDAYLR--KQHKLNKTIIVRLVTQPGNGHFDATVLSKNET 610
            .|::.:      ||...|..|    |..|:|  :.:|::..     .|.....||:..|....||
 Worm   523 LNVSEI------CETFRLSKVTSLIEYGYVRTMRTYKISVE-----TTISSYAHFETFVTYDIET 576

  Fly   611 SLQ--GPITRTDQYRHQSFCA---REAPIEIYCYC 640
            .:.  ..:||.|.|...:.|.   |::|:   |||
 Worm   577 DIAKFEKVTRLDNYAMTTDCTKPIRQSPL---CYC 608

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14731NP_650130.1 DUF229 77..573 CDD:281053 141/580 (24%)
ALP_like 200..485 CDD:293745 89/315 (28%)
T07G12.3NP_501945.2 DUF229 67..538 CDD:281053 135/540 (25%)
ALP_like 161..448 CDD:293745 90/320 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D306348at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10974
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
33.070

Return to query results.
Submit another query.