DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14731 and F15H10.7

Sequence 1:NP_650130.1 Gene:CG14731 FlyBaseID:FBgn0037964 Length:641 Species:Drosophila melanogaster
Sequence 2:NP_505674.1 Gene:F15H10.7 WormBaseID:WBGene00008874 Length:666 Species:Caenorhabditis elegans

Alignment Length:656 Identity:147/657 (22%)
Similarity:274/657 (42%) Gaps:130/657 (20%)


  Fly    56 NSSQCQINSMDPFSPTAM-YHMTPMPSSACPMIKLMKPQSIDGMNYLYL------IASAKELWKK 113
            :.|:|.|...||:.|:.: |:..|.|.    :...|:.|::...|...|      |.:|:  ..|
 Worm    58 SKSECVIPDADPWDPSILSYYSKPSPL----VCSTMQVQAVKSFNNGILTFEPQVIKNAR--CYK 116

  Fly   114 LGVR---RLSDIFCAYKRFVRFNDFVNIYFESTLFRFSKLRNFTKVDSGNITLRVWCWMDYGRLV 175
            .|:|   .::|:...|::.|..|                |.:.:.:...:...::.|..|  .|:
 Worm   117 TGIRHDENVTDLDVIYEKPVPLN----------------LTHTSSIKISDEVFQITCESD--NLL 163

  Fly   176 YHDVFIFLPFPNPQKVNNSAPVKRL----------SVLILGIDSISHMHYQRYFSRVRDLIEGLP 230
            ..::|   .:...|.|..|:.:|..          ||:::|:||:|..::.|...:....::...
 Worm   164 KSEIF---KYHYTQIVPKSSNIKNKVIEQSTSDFPSVIMIGLDSMSRGNFVRQMQKTYKYMKEAG 225

  Fly   231 HTELWGYNRVGQNSYPNLIPLLSGQSVDEVEAKSGCYGASGGTNFDRCHLLWHDFQAAGYATIFG 295
            ..::.|:.::..|:|.||:.:|:|:....|:..|.....|....||....:|..|...||||:|.
 Worm   226 FIDMEGHMKIHDNTYGNLLAILTGKRGVGVKEFSTEINESWHIAFDEFDFIWKTFSDNGYATLFA 290

  Fly   296 EDSRVAGTFTY--VRPGFKKRPTDFYLR--------SVINEIHMRSTYFARGPLEIKCSGDRVYH 350
            ||....|||||  :..||.|:|||.|:|        |:|:...:.|           |......|
 Worm   291 EDRPDIGTFTYKNMLEGFLKQPTDHYIRPFWISAFWSLISRRSVAS-----------CYDSTPQH 344

  Fly   351 HVLYDFIYRLLPHMQARMYD-RGFFAFFWQTMGVHDYFQYGERADWEYYRIMRALKRRKILERTL 414
            .:...::...|     ..|| :..|||:|.....|.:.....:.|.::.:..:..::|  :|.::
 Worm   345 KIQLKYLEEFL-----EKYDKKRKFAFWWSQDMSHGFLNLIGKVDDDFEKFFKNNEKR--MEDSI 402

  Fly   415 VLIVSDHGLRYGPFVDTFQGMRETSLPIMVAIYPRSLRERFPLAFANLEANAHRLVTTYDLHETL 479
            :::.||||.||....:|..|..|:.:|......|..:::::|....||..|:..:.|.:|::::|
 Worm   403 IIVFSDHGHRYDKIRETVIGRIESRMPFHSIRIPDGIKKKYPQIVENLMVNSKLMTTQFDVNDSL 467

  Fly   480 KDVVDLENLSDERILNRTLRLRNNHNVSLFLPIPEERSCFSARIPLHYCQCDGYVKIPWNVRSIQ 544
            :      .::..::..:..:.....:.|.|.|.|:...|:.|.||..:|.|...::||      :
 Worm   468 R------KIATGKVGEKWTQTDRKRSYSYFDPFPKRIGCYEAGIPSDFCPCFSEIEIP------K 520

  Fly   545 RIAKLAVANINRL--------------------LAPYPQCEQLELLNVEDAYLR----------- 578
            ..||.|...:.|:                    |..| .|..:|:.|||.:.:|           
 Worm   521 SEAKEAAVELMRIVNDLLENTEKTEEYEPDSKELTEY-MCTPMEIQNVEFSSVRLPMLSVLKDVK 584

  Fly   579 ------KQHKLNKTIIVRLVTQPGNGHFDATV---LSKNETSLQGPITRTDQYRHQSFCAREAPI 634
                  :...|...::|| ...|.|...::|:   |..|..|..|.:.|.::|.:.|||..:..:
 Worm   585 SEDTPLQSFSLQYHVVVR-AKAPSNALLESTLEHNLKTNTWSSLGEVERNNKYGNTSFCVNDRIL 648

  Fly   635 EIYCYC 640
            :..|:|
 Worm   649 KKICHC 654

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14731NP_650130.1 DUF229 77..573 CDD:281053 121/546 (22%)
ALP_like 200..485 CDD:293745 75/306 (25%)
F15H10.7NP_505674.1 DUF229 79..568 CDD:281053 121/547 (22%)
ALP_like 195..472 CDD:293745 75/301 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C130874299
eggNOG 1 0.900 E1_28JJT
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10974
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
54.900

Return to query results.
Submit another query.