DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14731 and F07C3.3

Sequence 1:NP_650130.1 Gene:CG14731 FlyBaseID:FBgn0037964 Length:641 Species:Drosophila melanogaster
Sequence 2:NP_505391.4 Gene:F07C3.3 WormBaseID:WBGene00017194 Length:746 Species:Caenorhabditis elegans

Alignment Length:601 Identity:138/602 (23%)
Similarity:231/602 (38%) Gaps:150/602 (25%)


  Fly     5 QCFVEIKKNSFRLILMCIILYVLINFREQVEHKMKEQPPIEGKPDNKMLFVNSSQCQINSMDPFS 69
            ||.|:|.:...|.           ..|...::.|..:..:| .|.|:.||||:....||      
 Worm   156 QCKVDIIEGGLRK-----------PERNMTKNSMFIKKTLE-IPSNERLFVNADAFVIN------ 202

  Fly    70 PTAMYHMTPMPSSACPMIKLMKPQSIDGMNYLYLIASAKELWKKLGVRRLSDIFCAYKRFVRFND 134
               .|:.:.         |.:||:              ..:|||                     
 Worm   203 ---CYNHSK---------KAVKPE--------------VPIWKK--------------------- 220

  Fly   135 FVNIYFESTLFRFSKLRNFTKVDSGNITLRV---WCWMDYGRLVYHDVFIFLPFPNPQKVNNSAP 196
                     .|...|.:|..:.:    .|||   :.:.|||..:...|              |..
 Worm   221 ---------PFPGMKDKNLPEDE----ILRVKDLYSYGDYGNKIREQV--------------SKA 258

  Fly   197 VKRLSVLILGIDSISHMHYQRYFSRVRDLIEGLPHTELWGYNRVGQNSYPNLIPLLSGQSVDEVE 261
            |.|.|:.|||.||.:...:.|:..|..:::..|.:..|:||.:|..||..||.|:|.|   |..|
 Worm   259 VDRYSIDILGFDSTARTMFMRHMPRTVEVMAKLDYHYLYGYTKVADNSMVNLAPILVG---DMEE 320

  Fly   262 A-KSGCYGASGGTNFD------------RCHLLWHDF-QAAGYATIFGED--SRVAGTFTY---- 306
            | |...|..||..|.:            :.:.||... :..|..::|.||  ::..|.|.|    
 Worm   321 ALKKPKYDKSGDFNINWLLPTEDKMDPTKLNFLWKIMKEKYGCESLFNEDISTKGLGLFNYPPTE 385

  Fly   307 VRPGFKKRPTDFYLRSVINEIHMRSTYFARGPLEIKC-SGDRVYHHVLYDFIYRLLPHMQARMYD 370
            .:|||.:.|.|.|.|:....::....|.|       | .|:::.:..:.  |:|...|   |..:
 Worm   386 FQPGFTENPADHYYRAYYLAVYENWKYEA-------CRDGEQLQNEFVN--IWRRFAH---RYRN 438

  Fly   371 RGFFAFFWQTMGVHDYFQYGERADWEYYRIMRALKRRKILERTLVLIVSDHGLRYGPFVDTFQGM 435
            ...|.|.:.|...|:.....|..|.:....:..:.....|:.||.:|:.|||.|.|.....:.|.
 Worm   439 ICHFGFTFVTTLTHEAGLVLEILDEKLAAHLSQMHLNGDLDNTLSIIMGDHGNRIGAIKSRYTGR 503

  Fly   436 RETSLPIMVAIYPRSLRERFPLAFANLEANAHRLVTTYDLHETLKDVVDLENLSDERILNRTLRL 500
            .|..:|:|...:|....|.:|:.:.|...|.|:|.:.:|:|:||.|:|.:      |:.:...:.
 Worm   504 IEERMPLMAMRFPTGFAETYPVEYKNFLDNKHKLTSNFDVHKTLHDIVHM------RLGDNKAKS 562

  Fly   501 RNNHNVSLFLPIPEERSCFSARIPLHYCQCDGYVKIPWNVRSIQRIAKLAVANINRLLAPYPQCE 565
            .....:|||..||..|:|....:|.::|.|         :..:..||. .:.|.|:   ..|..:
 Worm   563 DEGRGISLFDAIPNTRTCADVIVPENFCMC---------MIDVSSIAN-PLPNFNK---KKPTDQ 614

  Fly   566 QLELLNVEDAYLRKQH 581
            :::..|...::|:.::
 Worm   615 KMDQFNTLKSWLKTEN 630

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14731NP_650130.1 DUF229 77..573 CDD:281053 120/520 (23%)
ALP_like 200..485 CDD:293745 84/306 (27%)
F07C3.3NP_505391.4 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_28JJT
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10974
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.