DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14731 and R03G8.3

Sequence 1:NP_650130.1 Gene:CG14731 FlyBaseID:FBgn0037964 Length:641 Species:Drosophila melanogaster
Sequence 2:NP_510174.3 Gene:R03G8.3 WormBaseID:WBGene00010998 Length:654 Species:Caenorhabditis elegans

Alignment Length:688 Identity:155/689 (22%)
Similarity:276/689 (40%) Gaps:126/689 (18%)


  Fly    17 LILMCIILY-VLINFRE-----QVEHKMKEQPPIEGKPDNKMLFVNS-----SQCQINSMDPFSP 70
            |:..|..:| ||:.|..     ..:..:....||.|...:|::...|     .||::...|.:..
 Worm    17 LVTGCFAMYLVLLGFTMFSPLLSPQQYLGLYQPISGNIPSKVVMNKSEVEPWDQCELPQYDIWDD 81

  Fly    71 TAM--YHMTPMPSSACPMIKLMKPQSIDGMNYLYLIASAKELWKKLGVRRLSDIFCAYKRFVRFN 133
            ..:  .:|...|.|.|       .:|.:.:.:|     ....|..  |.:.:.:.|..:...|.:
 Worm    82 EILPYLNMEVNPISNC-------NKSREPLTFL-----NNGSWGV--VNKKTKLICRARCHTRKS 132

  Fly   134 DFVNIYFESTLFRFSKLRNFTKVDSGNITLRV---WCWMDYGRLVY---HDVFIFLPFPNPQ-KV 191
            :           |::.:.|:| ...|.|...|   .| .|..:.||   |...|..|...|. ||
 Worm   133 E-----------RYNVIGNWT-YTPGPINCEVVEAVC-ADGKKDVYGFLHTQVIATPPKQPTVKV 184

  Fly   192 NNSAPVKRLSVLILGIDSISHMHYQRYFSRVRDLIEGLPHTELWGY-NRVGQNSYPNLIPLLSGQ 255
            :.   :|...|.::.:||:|....:|...|....:.......|:.| |:||.||.||...|..|:
 Worm   185 SE---LKNYDVTVIMLDSLSFTQAKRSLLRTISYMTNHMDAVLFPYINKVGDNSRPNGAALWFGK 246

  Fly   256 SVDEVEAK-----------SGCYGASGGTNFDRCHL-------LWHDFQAAGYATIFGEDSRVAG 302
            |:::::..           |..|         .||:       |:.::|..||.|:..|| ...|
 Worm   247 SLEKLDRSLFEEENVPVDWSHAY---------MCHVYKDNETSLFKEYQNYGYKTLMAED-WAEG 301

  Fly   303 TFTYVR-PGFKKRPTDFYLRSVINEI------------HMRSTYFARGPLEIKCSGDRVYHHVLY 354
            |..:.. .||.|.|.|..:|...|.:            |:::..:        |..|   ||.|.
 Worm   302 TLNWPNCKGFDKPPIDHLMRPFQNALERANHGEPLTKSHLKNQKY--------CRED---HHTLL 355

  Fly   355 DFIYRLLPHMQARMY-DRGFFAFFWQTMGVHDYFQYGERADWEYYRIMRALKRRKILERTLVLIV 418
            |::.:.:     ..| |:..|.:.|.::..||.......:|.::::.:  :|.|:.|:.:.|..:
 Worm   356 DYLSQFI-----NAYPDQNKFRWIWASILGHDSENGFPHSDKDFHKFL--IKHREQLDNSFVFFM 413

  Fly   419 SDHGLRYGPFVDTFQGMRETSLPIMVAIYPRSLRERFPLAFANLEANAHRLVTTYDLHETLKDVV 483
            .|||||:|....||.|..:.|.|.:....|::||:...|... :..||.::.|.:|...|:.|::
 Worm   414 GDHGLRFGNVRKTFVGTLDVSNPFLAVSIPKNLRQTTGLLNV-MRENAQKIQTHFDTRATMLDIL 477

  Fly   484 DLENLSDERILNRTLRLRNNHNVSLFLPIPE-ERSCFSARIPLHYCQCDGYVKIPWNVRS----- 542
            ..::.|:...|: .|.:......|.....|: .|:|.:..||:.||.|. :.|...:.:|     
 Worm   478 KYQSASNFTDLD-PLIIPGEKGYSYIRTQPDILRNCRNMPIPMQYCICQ-FNKTQVSTKSETAKG 540

  Fly   543 IQRIAKLAVANINRLLAPYPQCEQLELLNVEDAYLRKQHKLNKTIIVRLV---TQPGNGHFDATV 604
            :.....|||.|.........:|.::::.:|. :.|:...|...:::...|   |:|....:.|.|
 Worm   541 VGEAVALAVNNEIEEGKFTDKCVKMKVDHVV-SLLQFDQKFKGSMLYTAVVEMTKPSKAVYKANV 604

  Fly   605 --LSKNETSLQGPITRTDQYRHQSFCAREAPIEIYCYC 640
              |...|..:.|.:.|:::|...::|........||||
 Worm   605 KILENGEVKVLGMVERSNKYGSTAYCIGSEHHRPYCYC 642

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14731NP_650130.1 DUF229 77..573 CDD:281053 123/542 (23%)
ALP_like 200..485 CDD:293745 77/318 (24%)
R03G8.3NP_510174.3 DUF229 92..570 CDD:281053 122/539 (23%)
ALP_like 190..480 CDD:293745 77/319 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D306348at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10974
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
33.070

Return to query results.
Submit another query.