| Sequence 1: | NP_650130.1 | Gene: | CG14731 / 41442 | FlyBaseID: | FBgn0037964 | Length: | 641 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_510174.3 | Gene: | R03G8.3 / 181437 | WormBaseID: | WBGene00010998 | Length: | 654 | Species: | Caenorhabditis elegans | 
| Alignment Length: | 688 | Identity: | 155/688 - (22%) | 
|---|---|---|---|
| Similarity: | 276/688 - (40%) | Gaps: | 126/688 - (18%) | 
- Green bases have known domain annotations that are detailed below.
| 
 
  Fly    17 LILMCIILY-VLINFRE-----QVEHKMKEQPPIEGKPDNKMLFVNS-----SQCQINSMDPFSP 70 
  Fly    71 TAM--YHMTPMPSSACPMIKLMKPQSIDGMNYLYLIASAKELWKKLGVRRLSDIFCAYKRFVRFN 133 
  Fly   134 DFVNIYFESTLFRFSKLRNFTKVDSGNITLRV---WCWMDYGRLVY---HDVFIFLPFPNPQ-KV 191 
  Fly   192 NNSAPVKRLSVLILGIDSISHMHYQRYFSRVRDLIEGLPHTELWGY-NRVGQNSYPNLIPLLSGQ 255 
  Fly   256 SVDEVEAK-----------SGCYGASGGTNFDRCHL-------LWHDFQAAGYATIFGEDSRVAG 302 
  Fly   303 TFTYVR-PGFKKRPTDFYLRSVINEI------------HMRSTYFARGPLEIKCSGDRVYHHVLY 354 
  Fly   355 DFIYRLLPHMQARMY-DRGFFAFFWQTMGVHDYFQYGERADWEYYRIMRALKRRKILERTLVLIV 418 
  Fly   419 SDHGLRYGPFVDTFQGMRETSLPIMVAIYPRSLRERFPLAFANLEANAHRLVTTYDLHETLKDVV 483 
  Fly   484 DLENLSDERILNRTLRLRNNHNVSLFLPIPE-ERSCFSARIPLHYCQCDGYVKIPWNVRS----- 542 
  Fly   543 IQRIAKLAVANINRLLAPYPQCEQLELLNVEDAYLRKQHKLNKTIIVRLV---TQPGNGHFDATV 604 
  Fly   605 --LSKNETSLQGPITRTDQYRHQSFCAREAPIEIYCYC 640  | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| CG14731 | NP_650130.1 | DUF229 | 77..573 | CDD:281053 | 122/541 (23%) | 
| ALP_like | 200..485 | CDD:293745 | 77/317 (24%) | ||
| R03G8.3 | NP_510174.3 | DUF229 | 92..570 | CDD:281053 | 122/538 (23%) | 
| ALP_like | 190..480 | CDD:293745 | 77/318 (24%) | 
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 1 | 1.010 | - | - | D306348at33208 | |
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | O | PTHR10974 | 
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 1 | 0.960 | - | - | ||
| 4 | 3.980 | |||||