DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14731 and F10C2.3

Sequence 1:NP_650130.1 Gene:CG14731 FlyBaseID:FBgn0037964 Length:641 Species:Drosophila melanogaster
Sequence 2:NP_506015.2 Gene:F10C2.3 WormBaseID:WBGene00008644 Length:604 Species:Caenorhabditis elegans

Alignment Length:669 Identity:167/670 (25%)
Similarity:300/670 (45%) Gaps:119/670 (18%)


  Fly    14 SFRLILMC--IILYVLINFREQVEHKMKEQPPIEGKPDNKMLFVNSSQCQINSMDPFSPTAMYHM 76
            :|.|..:|  :.|:..:.....:...:|.:..:..:..|     :||:|.:.::||:..:.:.::
 Worm     7 AFVLFFLCTTVFLFPDLFASSTISRNLKTRRSVARQKQN-----SSSKCVVPTLDPWDQSILEYV 66

  Fly    77 TPMPSS----ACPMIKLMKPQ--SIDGMNYLYLIASAKELWKKLGVRRLS-DIFCAYKRF----- 129
            ....|.    ||...| ::|:  .:|....|.|.::|        |...| .:.|.|:.:     
 Worm    67 LDDGSRPTQLACHDAK-VQPELTFLDENGVLQLNSTA--------VSESSLKVECQYRTYDKMDG 122

  Fly   130 ----------VRFNDFVNIYFESTLFRFSKLRNF---TKVDSGNITLRVWCWMDYGRLVYHDVFI 181
                      :.||  :::..||.....|..|.:   |||.|.|                |:..|
 Worm   123 DDEQLNYSEWISFN--MSVKIESEFVEVSCQRAWFPRTKVYSNN----------------HNQII 169

  Fly   182 FLPFPNPQKVNNSAPVK-RLSVLILGIDSISHMHYQRYFSRVRDLIEGLPHTELW-GYNRVGQNS 244
                    .::.|.||. :.||:::.:||:||.:::|..::..|::..|..:.:: |..::|.||
 Worm   170 --------PISRSQPVSDKSSVIVIVLDSVSHSNFRRTMNKTLDVMHSLYGSFIFDGMTKIGDNS 226

  Fly   245 YPNLIPLLSGQSVDEVEAKSGCYGASGGTNFDRCHLLWHDFQAAGYATIFGEDSRVAGTFTYVRP 309
            :.|.:...:|:..:..      :|.:.| .||...|:|..::..||.|::.||......|.|:..
 Worm   227 FSNAVGFFAGKWWNTE------FGDAHG-YFDDHDLIWKHYRENGYRTLYAEDYPGFNLFNYLSK 284

  Fly   310 GFKKRPTDFYLRSVINEIHMRSTYFARGPLEIKCSGDRVYHHVLYDFIYRLLPHMQARMYDRGFF 374
            ||||:|.|.|.|.....::.  ||..|....: |.|:...|::..:::.:.:    ::..|:..|
 Worm   285 GFKKKPVDHYFRPYWLNVYW--TYVHRRSRNL-CYGNHRMHNLQLNYLSQFV----SKYKDQPKF 342

  Fly   375 AFFWQTMGVHDYFQYGERADWEYYRIMRALKRRKILERTLVLIVSDHGLRYGPFVDTFQGMRETS 439
            |..|.|...||:.......|.:....::  |..:.||.:.:.|:||||.|:.....|..|..|..
 Worm   343 AISWLTELGHDWLNQVRYGDEDLANFLK--KHVEDLENSYLFIMSDHGHRFDNIRKTSIGRLEER 405

  Fly   440 LPIMVAIYPRSLRERFPLAFANLEANAHRLVTTYDLHETLKDVVDLENLSDERILNRTLRLRNNH 504
            ||......|:.||:...|. ..:..|:.:|.:.:|::.|.:           .|||.:.:.....
 Worm   406 LPFFSVSLPKKLRKDSKLV-DTVRKNSKKLTSFFDVYATFR-----------HILNNSKQPDVMR 458

  Fly   505 NVSLFLPIPEERSCFSARIPLHYCQCDGYVKIPWNVRSIQRIAKLA---VANINRLLAPYPQCEQ 566
            ..|||||| ::|:|.:|.||..:|.||  .::|.||.:..:|..:|   ..:||:.|.|:|||.|
 Worm   459 GESLFLPI-KDRNCETAHIPEEFCVCD--TEVPLNVSANAQIRTMAEDFAKDINQRLDPHPQCVQ 520

  Fly   567 LELLN------VEDAYLRKQHKLNKTIIVRLVTQPGNGHFDATVL---SKNETSLQGPITRTDQY 622
            |.|.|      |.|.   |:.:...||.|    .|.|..|:|.:|   .:::|::.|.|.|.::|
 Worm   521 LYLKNVISVSQVGDV---KEQRYRFTIEV----SPSNAIFEALLLYDPFESQTTVIGDINRINKY 578

  Fly   623 RHQSFCAREAPIEIYCYCS 641
            .:||.|.::..:...|:||
 Worm   579 GNQSLCVQDQFLRKLCFCS 597

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14731NP_650130.1 DUF229 77..573 CDD:281053 135/532 (25%)
ALP_like 200..485 CDD:293745 72/286 (25%)
F10C2.3NP_506015.2 DUF229 110..527 CDD:281053 123/474 (26%)
ALP_like 182..451 CDD:293745 75/297 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10974
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
33.070

Return to query results.
Submit another query.