DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14731 and Y38A10A.2

Sequence 1:NP_650130.1 Gene:CG14731 FlyBaseID:FBgn0037964 Length:641 Species:Drosophila melanogaster
Sequence 2:NP_504570.2 Gene:Y38A10A.2 WormBaseID:WBGene00021389 Length:599 Species:Caenorhabditis elegans

Alignment Length:395 Identity:68/396 (17%)
Similarity:141/396 (36%) Gaps:118/396 (30%)


  Fly   172 GRLVYHDVFIFLPFPNPQKVNNSAPVKRL-------SVLILGIDSISHMHYQRYFSRVRDLIEGL 229
            |:.:|...|.     |.:|.....||:.:       |:.:|.:.|:||...||.|.:........
 Worm   149 GKRIYRKSFY-----NYKKDQAEKPVEAMESTPTSPSIAVLYLRSMSHSQLQREFPKTVKASRKF 208

  Fly   230 PHTELWGYNRVGQNSYPNLIPLLSGQSVDEVEAKSGCYGASGGTNFDRCHLLWHD---------F 285
            ...:...:|::..    |:..:::|                         ..||.         .
 Worm   209 GFYDFAMFNKISD----NITDIVNG-------------------------TFWHKDVRHTVGEYM 244

  Fly   286 QAAGYATIFGEDSRVAGTFTYVRPGFKKRPTDFYLRSVINEIH-MRSTYFARGPLEIKCSGDRVY 349
            :...:..:| .::.::|.           |:|:   .:.|..| ::|.         .||.|   
 Worm   245 KNERFCKVF-SNTNLSGV-----------PSDY---DISNWAHSLKSD---------SCSDD--- 282

  Fly   350 HHVLYDFIYRLLPHMQARMYDRGFFAFFWQTMGVHD----YFQ--------YGERADWEYYRIMR 402
                        ..:..|:.::      |....:|:    |..        :.:..|.....:|.
 Worm   283 ------------DSVSERLIEQ------WAQFSIHNTDHCYLSHIFVNNTIWSKSLDDTLSSVMN 329

  Fly   403 ALKRRKILERTLVLIVSDHGLRYGPFVDTFQGMRETSLPIMVAIYPRSLRERFPLAFANLEANAH 467
            ..:..::.:.|||::||..|:..|.|.:::.|..|...||::|..|..:::.:.....:||:|.:
 Worm   330 QFQLNEVFKNTLVVVVSAEGIPVGTFGNSYTGKVEERNPILLAHIPDKVKKLYSDHVFHLESNQN 394

  Fly   468 RLVTTYDLHETLKDVVDLENLSDERILNRTL------RLRNNHNVSLFLP-IPEERSCFSARIPL 525
            ||:|..::.:.|   .....||..:::...|      :.::...:|.:.. ||..|:|:...|..
 Worm   395 RLITHLEVFDLL---TSFSRLSKNQVIVPVLDDFMDWKRKHVRGISPWQTLIPRNRTCYHVPIAD 456

  Fly   526 HYCQC 530
            .:|.|
 Worm   457 EFCLC 461

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14731NP_650130.1 DUF229 77..573 CDD:281053 68/396 (17%)
ALP_like 200..485 CDD:293745 50/314 (16%)
Y38A10A.2NP_504570.2 DUF229 72..465 CDD:281053 68/396 (17%)
ALP_like 179..405 CDD:304875 49/300 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10974
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
22.060

Return to query results.
Submit another query.