DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14731 and Y73F8A.35

Sequence 1:NP_650130.1 Gene:CG14731 FlyBaseID:FBgn0037964 Length:641 Species:Drosophila melanogaster
Sequence 2:NP_001255870.1 Gene:Y73F8A.35 WormBaseID:WBGene00013539 Length:654 Species:Caenorhabditis elegans

Alignment Length:693 Identity:161/694 (23%)
Similarity:277/694 (40%) Gaps:138/694 (20%)


  Fly    17 LILMCIILYV-LINFREQVEHKMKEQ-----PPIEGK-PDNKMLFVNS---SQCQINSMDPFSPT 71
            ||:.|.|.|: |:.|...|......|     .||.|| .:|..|.|..   .:|.:...:.::..
 Worm    14 LIITCFITYLGLLAFTLLVPAPTSIQYVGVYQPIFGKLEENGSLVVKGDLWDRCDLPDYEIWNDD 78

  Fly    72 AM--YHMTPMPSSACPMIKLMKPQSIDGMNYLYLIASAKELWKKLGVRRLSDIFCAYKRFVRFND 134
            .:  .:|...|.:.|   .:..|.:       |||..:   |..:......|  |..:...|.:|
 Worm    79 ILKYLNMDETPITKC---NIAPPLT-------YLINGS---WNAVNASAGYD--CKTRCHWRKDD 128

  Fly   135 FVNIYFESTLFRFSKLRNFTKVDSGNIT--------LRVWCWMD----YGRLVYHDVFIFLPFPN 187
            ..|.                 :.:.|.|        |...|..|    ||.:  |...|..| |.
 Worm   129 RTNF-----------------IGNWNSTPGPVDCEFLEAICLKDNLKVYGYM--HSQIIPTP-PI 173

  Fly   188 PQKVNNSAPVKRLSVLILGIDSISHMHYQRYFSRVRDLIEGLPHTELWGY-NRVGQNSYPNLIPL 251
            ..||:.| .:::..|.::.:||::|....|...|....:.......::.| |:||:||..|.:||
 Worm   174 TPKVDVS-KLQQYDVTVILLDSLAHAQALRSLPRAISYMTSHMSAVVFPYVNKVGENSRSNGVPL 237

  Fly   252 LSGQSVDEVEAKSGCYGASGGTNFDR------------CH-------LLWHDFQAAGYATIFGED 297
            ..|:|:::::.          :.||.            |:       .::::|:..||.|:..||
 Worm   238 WFGKSLEKLDK----------SLFDEEDVTVDWTHEYMCNEFKDNETSIFNEFRDYGYKTLLAED 292

  Fly   298 SRVAGTFTYVR-PGFKKRPTDFYLRSVINEIHM--RSTYFARGPLEIKCSGD--RVYHHVLYDFI 357
             ...||..:.. .||...|.|.|:|...|.:..  ...:..|..|.   .|:  |.:|:.|.:::
 Worm   293 -WAEGTLNFPNCKGFDNPPIDHYMRPFQNALERPHHGEFITRNHLS---PGNLTREHHNTLLEYL 353

  Fly   358 YRLLPHMQARMYDRGFFAFFWQTMGVHDYFQYGERADWEYYRIMRALKRRKILERTLVLIVSDHG 422
            .:.   |.|...::. |::.|.:...||.......||.::|..:  :|.|:.|:.:.|:::.|||
 Worm   354 SKF---MNAYPNEKK-FSWIWASHLGHDSMNGFSHADNDFYNFL--VKHREKLDNSFVILMGDHG 412

  Fly   423 LRYGPFVDTFQGMRETSLPIMVAIYPRSLRERFPLAFANLEANAHRLVTTYDLHETLKDVVDLE- 486
            .|:|....|..|..|...|.:....|::||:...: .:.::.||.:|.|.||...|:.|::..: 
 Worm   413 PRFGANRKTVSGELEVHNPFLGISIPKALRKTTEI-LSLMKGNAKKLQTHYDTRATILDILKYQS 476

  Fly   487 --NLSDERILNRTLRLRNNHNVSLFLPIPE-ERSCFSARIPLHYCQCDGYVKIPWNVRSI----- 543
              |..|..|    |::......|.....|: .|:|.:..||:.||.|    |......||     
 Worm   477 TTNFLDTEI----LKIPGEKGFSFIRKQPDTPRNCKTMPIPIQYCLC----KFNRTTESIHSDLA 533

  Fly   544 QRIAKLAVANINRLLAP---YPQCEQLE---LLNVEDAYLRKQHKLNKTIIVRLVTQ---PGNGH 599
            ..:||...|.:|..|..   ..:|.::|   :|:::    |...|...:|:..:|.:   |.|..
 Worm   534 HSMAKALTAAVNTELENGKLQSRCIKMEYSIILSLD----RLDEKFRGSILYTIVVEMKKPSNAW 594

  Fly   600 FDATV--LSKNETSLQGPITRTDQYRHQSFCAREAPIEIYCYC 640
            |.|.:  ||..|..:.|.|.|.::|...:.|.:......||:|
 Worm   595 FKANIKMLSTGELKVLGIIERVNEYGQTAHCIKSEYHRPYCFC 637

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14731NP_650130.1 DUF229 77..573 CDD:281053 124/548 (23%)
ALP_like 200..485 CDD:293745 74/310 (24%)
Y73F8A.35NP_001255870.1 DUF229 89..557 CDD:281053 121/533 (23%)
ALP_like 185..475 CDD:293745 74/311 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10974
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
22.060

Return to query results.
Submit another query.